Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037463 (Fbxo27)
Chromosomal location
Chr 7: 29477868 - 29484354 (+)
Description
F-box protein 27 Gene [Source:MGI (curated);Acc:Fbxo27-001]
RefSeq_dna
NM_207238 
RefSeq_peptide
NP_997121.1 
UniGene
Mm.116116 
MGI
MGI:2685007 
Uniprot/SWISSPROT
Q6DIA9 
Uniprot/SPTREMBL
Q3TEI7 
Human Ortholog
ENSG00000161243 (FBXO27)
Omim not available
UniTrap UNI33041
Vector Insertion
Chr 7: 29477992 - 29478162
Public Clones IST14447H8 (tigm) IST10358H2 (tigm) IST13746D2 (tigm) IST11569G1 (tigm)
IST13776H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20178
Vector Insertion
Chr 7: 29478288 - 29478670
Public Clones not available
Private Clones OST370047 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108280
Sequence
GAGAGACAGGATGCACAGAGAGGCACCAAGAGCAATTAAAATCAACACATAAATATCTTTTGTTTCATTGGCTTTTACATTTTAACAATTTATTTTCGTC

CCTGCGCCTGGAGTTTCAGGAGACTAAGCCTCATGGCTTGGGAGCTGGGAACTGACCCCAGGTCCTCTAGAAGAGCAGTTACAAATTTTTAAATTTTGTT

AGTATATTTTGTTTTTGTTGTTGTTTTGCTTTTTGTTTTTGCGGGTTGGAAAGATAGCTCAGCGGCTAAGAGCTGCTCCTCCAAAGGACCTAAGCTCAGT

TCCAAACACTCAAGTGGAGACTCACAACCATCTGTAACTCAAGTCTCAGGGAGACCACCCTTTCTTCTGGCCTCTGGAGAGAGGGCATATATACATAGTC

TGCAGACATAAACTTTTAATTTTTTAAAATTATTTTGGTGTGTTGTTAAAAGGCTCAAGTCTCGCGTACAGGTGGTAGGTGCTCAGCGGCCAACTTTGTA

TCCACAGTTCTCTCCTTGTATTTCTGCGTGAAGTCTGATGATTAATTAGGCTAAAGTTTTCCCACTGAGCCGTCCTTCCTGCCTGCTCAG AAGGCCTGC

GCAAATGGATGGTGCGGCACGGTGGGGATGGATGGGTGGTGGAGAAGAACAGGAAACCTGTACCTGGGGCCCCTTCACAGACCTGCTTCGTGACTTCCTT

CAG CTGGTGTCGCAAGAAGCAGGTCGTGGACCTGGTGGAGAAGGGTCTGTGGCCAGAGCTGCTGGACAGTGGTGGTGTGGAGATTGCTGTCTCTGACTG

 GTGGGGAGCTCGACATGACAGTGGCTGTAAGTACCGTCTCTTTGTCACGCTTCTTGATGCCCACCAGAACGTCATAGATAAGTTCTCCGCTGTGCCAGA

TCCCATTGAACAGTGGAACAATGATATCTACCTGCAG GTCACCCACGTGTTCTCCGGCATCAGGAGGGGCATACGTTTTGTCTCTTTTGAACACTGGGG

CCAGGACACACAGTTCTGGGCTGGCCACTATGGGGCCAGAGTGACGAACTCCAGTGTGATCATACGAGTCTGTCAGTCCTAGTCAAAAGGCCGCCATTTT

GGCAAGACAATCTGAATGTGCCTTCCTGGAGCTGTCGGCTGGAATCCCTCATGAGTCAAGTACTGTACCTCCCTGGCACATGAAACTCTGGGATCCAGTG

AAGGGTCCTGCTTGGTCTTGTTTTCAGAGTCTGTAACATTGAAGCCCTCCATCAGATCTACCTATTACTGCTGCTTTAGAGCATGAGTGCCTAGGTGCCT

GGATGCATGTGTGCCCGGATGCATGGATGCCTGGGTTCCTAGATGCATAGATGCCTGGGTGCCTGGATGCATGGATGCCTGGGTGCCCGGATGCATGGAT

GCATGGGTGCCCGGATGCATGGGTGCATGCTGGTCTCAAGTCACAAGCTGCCTCTATTTCAGTTCGCTCACCTCTTTGCCCTGTCCCCAGTATTGATCCC

CCACCCTTTTTTGAGACAGGGCATCCCAGCTGGCGACAACCCTCCTTTCTGCCTTTGACACTCATGTGCTGGGACTACAGGCACACACCAGTACCACTCA

GTCTTGTGCAGTGCTGGGGATGAGCCCAGGGTTTCATGCATGCCAGCAAACATTCTACTATCTGAGCAATGTCCCCAGTGTCCCCTCTGGTCATGTCCTG

TTTCTGCCTCAGGGATTGTCTCTGTTCCTTCGCTGAGGCCCTCTACTTAGGGCTGAACATAGGATTTATGGCTAGCAGAATTCCAGCTCCCTTGGGTAAG

GAACCAAAGCTCTCTTGGCTATAGCCAGCCTCCTCATTGAAGGGTGTTTTAGGGTATCTGCCCACAGATTTTCTCCAAACAATTGGGAAGTGCCTAGAGT

CCAGGCCCCGATCATCAAAGATGTCTATATTGTATAATATTTAAAGTTATTTTTAATTTTCTCAAACAATATGAGAATATCTATCTGGCATTATCTATCT

GCCAATCTCACTGTAATAAATTGATTATTTTGCCT
Translation
 MVRHGGDGWVVEKNRKPVPGAPSQTCFVTSFS SWCRKKQVVDLVEKGLWPELLDSGGVEIAVSDW WWGARHDSGCKYRLFVTLLDAHQNVIDKFSAV

PDPIEQWNNDIYLQ VTHVFSGIRRGIRFVSFEHWGQDTQFWAGHYGARVTNSSVIIRVCQS
Transcript ENSMUST00000108281
Sequence
AGAGAGGCGGTAAGGGACGTGGGAGACAGTGGATGGCTTCGGGGATGTTAGTCTCGGGGTGGACGGCTGCAAAGCCTGGCAGCAGAGGCTGCTAATCACT

AACATCTAACCCCTCTTCTCCTGCAGTCCCAGCCAAGCGGGGCGCGGGGACCATGGGTGCCTGGATATCCAGGACCCGGGTCCCGACGCCGGAGCCCGAC

CCCCAGGAGGTCCTGGACCTGAGCCGTCTGCCCCCGGAGCTGCTCCTGCTGGTACTGAGCCACGTGCCCCCGCGCACGCTGCTGATGCACTGCCGCCGAG

TGTGCCGCGCCTGGCGCGCCCTGGTAGATGGCCAGGCCCTATGGTTGCTGCTGCTGGCCCGTGACCACAGCGCAGCGGGCCGCGCCCTGCTGACACTAGC

CCGCCGCTGTCTGCCCCCTGCCCACGAAGACACGCCCTGCCCGCTGGGCCAATTCTGCGCACTGAGACCGCTAGGACGCAACCTCATCAGCAACCCCTGT

GGCCAAG - UNI20178 - AAGGCCTGCGCAAATGGATGGTGCGGCACGGTGGGGATGGATGGGTGGTGGAGAAGAACAGGAAACCTGTACCTGGGGC

CCCTTCACAGACCTGCTTCGTGACTTCCTTCAG CTGGTGTCGCAAGAAGCAGGTCGTGGACCTGGTGGAGAAGGGTCTGTGGCCAGAGCTGCTGGACAG

TGGTGGTGTGGAGATTGCTGTCTCTGACTG GTGGGGAGCTCGACATGACAGTGGCTGTAAGTACCGTCTCTTTGTCACGCTTCTTGATGCCCACCAGAA

CGTCATAGATAAGTTCTCCGCTGTGCCAGATCCCATTGAACAGTGGAACAATGATATCTACCTGCAG GTCACCCACGTGTTCTCCGGCATCAGGAGGGG

CATACGTTTTGTCTCTTTTGAACACTGGGGCCAGGACACACAGTTCTGGGCTGGCCACTATGGGGCCAGAGTGACGAACTCCAGTGTGATCATACGAGTC

TGTCAGTCCTAGTCAAAAGGCCGCCATTTTGGCAAGACAATCTGAATGTGCCTTCCTGGAGCTGTCGGCTGGAATCCCTCATGAGTCAAGTACTGTACCT

CCCTGGCACATGAAACTCTGGGATCCAGTGAAGGGTCCTGCTTGGTCTTGTTTTCAGAGTCTGTAACATTGAAGCCCTCCATCAGATCTACCTATTACTG

CTGCTTTAGAGCATGAGTGCCTAGGTGCCTGGATGCATGTGTGCCCGGATGCATGGATGCCTGGGTTCCTAGATGCATAGATGCCTGGGTGCCTGGATGC

ATGGATGCCTGGGTGCCCGGATGCATGGATGCATGGGTGCCCGGATGCATGGGTGCATGCTGGTCTCAAGTCACAAGCTGCCTCTATTTCAGTTCGCTCA

CCTCTTTGCCCTGTCCCCAGTATTGATCCCCCACCCTTTTTTGAGACAGGGCATCCCAGCTGGCGACAACCCTCCTTTCTGCCTTTGACACTCATGTGCT

GGGACTACAGGCACACACCAGTACCACTCAGTCTTGTGCAGTGCTGGGGATGAGCCCAGGGTTTCATGCATGCCAGCAAACATTCTACTATCTGAGCAAT

GTCCCCAGTGTCCCCTCTGGTCATGTCCTGTTTCTGCCTCAGGGATTGTCTCTGTTCCTTCGCTGAGGCCCTCTACTTAGGGCTGAACATAGGATTTATG

GCTAGCAGAATTCCAGCTCCCTTGGGTAAGGAACCAAAGCTCTCTTGGCTATAGCCAGCCTCCTCATTGAAGGGTGTTTTAGGGTATCTGCCCACAGATT

TTCTCCAAACAATTGGGAAGTGCCTAGAGTCCAGGCCCCGATCATCAAAGATGTCTATATTGTATAATATTTAAAGTTATTTTTAATTTTCTCAAACAAT

ATGAGAATATCTATCTGGCATTATCTATCTGCCAATCTCACTGTAATAAATTGATTATTTTGCCT
Translation
MGAWISRTRVPTPEPDPQEVLDLSRLPPELLLLVLSHVPPRTLLMHCRRVCRAWRALVDGQALWLLLLARDHSAAGRALLTLARRCLPPAHEDTPCPLGQ

FCALRPLGRNLISNPCGQE - UNI20178 - EGLRKWMVRHGGDGWVVEKNRKPVPGAPSQTCFVTSFS SWCRKKQVVDLVEKGLWPELLDSGGVEI

AVSDW WWGARHDSGCKYRLFVTLLDAHQNVIDKFSAVPDPIEQWNNDIYLQ VTHVFSGIRRGIRFVSFEHWGQDTQFWAGHYGARVTNSSVIIRVCQS

Transcript ENSMUST00000108282
Sequence
AGAGAGGCGGTAAGGGACGTGGGAGACAGTGGATGGCTTCGGGGATGTTAGTCTCGGGGTGGACGGCTGCAAAGCCTGGCAGCAGAGGCTGCTAATCACT

AACATCTAACCCCTCTTCTCCTGCAGTCCCAGCCAAGCGGGGCGCGGGGACCATGGGTGCCTGGATATCCAGGACCCGGGTCCCGACGCCGGAGCCCGAC

CCCCAGGAGGTCCTGGACCTGAGCCGTCTGCCCCCGGAGCTGCTCCTGCTGGTACTGAGCCACGTGCCCCCGCGCACGCTGCTGATGCACTGCCGCCGAG

TGTGCCGCGCCTGGCGCGCCCTGGTAGATGGCCAGGCCCTATGGTTGCTGCTGCTGGCCCGTGACCACAGCGCAGCGGGCCGCGCCCTGCTGACACTAGC

CCGCCGCTGTCTGCCCCCTGCCCACGAAGACACGCCCTGCCCGCTGGGCCAATTCTGCGCACTGAGACCGCTAGGACGCAACCTCATCAGCAACCCCTGT

GGCCAAG - UNI20178 - GCCTGCGCAAATGGATGGTGCGGCACGGTGGGGATGGATGGGTGGTGGAGAAGAACAGGAAACCTGTACCTGGGGCCCC

TTCACAGACCTGCTTCGTGACTTCCTTCAG CTGGTGTCGCAAGAAGCAGGTCGTGGACCTGGTGGAGAAGGGTCTGTGGCCAGAGCTGCTGGACAGTGG

TGGTGTGGAGATTGCTGTCTCTGACTG GTGGGGAGCTCGACATGACAGTGGCTGTAAGTACCGTCTCTTTGTCACGCTTCTTGATGCCCACCAGAACGT

CATAGATAAGTTCTCCGCTGTGCCAGATCCCATTGAACAGTGGAACAATGATATCTACCTGCAG GTCACCCACGTGTTCTCCGGCATCAGGAGGGGCAT

ACGTTTTGTCTCTTTTGAACACTGGGGCCAGGACACACAGTTCTGGGCTGGCCACTATGGGGCCAGAGTGACGAACTCCAGTGTGATCATACGAGTCTGT

CAGTCCTAGTCAAAAGGCCGCCATTTTGGCAAGACAATCTGAATGTGCCTTCCTGGAGCTGTCGGCTGGAATCCCTCATGAGTCAAGTACTGTACCTCCC

TGGCACATGAAACTCTGGGATCCAGTGAAGGGTCCTGCTTGGTCTTGTTTTCAGAGTCTGTAACATTGAAGCCCTCCATCAGATCTACCTATTACTGCTG

CTTTAGAGCATGAGTGCCTAGGTGCCTGGATGCATGTGTGCCCGGATGCATGGATGCCTGGGTTCCTAGATGCATAGATGCCTGGGTGCCTGGATGCATG

GATGCCTGGGTGCCCGGATGCATGGATGCATGGGTGCCCGGATGCATGGGTGCATGCTGGTCTCAAGTCACAAGCTGCCTCTATTTCAGTTCGCTCACCT

CTTTGCCCTGTCCCCAGTATTGATCCCCCACCCTTTTTTGAGACAGGGCATCCCAGCTGGCGACAACCCTCCTTTCTGCCTTTGACACTCATGTGCTGGG

ACTACAGGCACACACCAGTACCACTCAGTCTTGTGCAGTGCTGGGGATGAGCCCAGGGTTTCATGCATGCCAGCAAACATTCTACTATCTGAGCAATGTC

CCCAGTGTCCCCTCTGGTCATGTCCTGTTTCTGCCTCAGGGATTGTCTCTGTTCCTTCGCTGAGGCCCTCTACTTAGGGCTGAACATAGGATTTATGGCT

AGCAGAATTCCAGCTCCCTTGGGTAAGGAACCAAAGCTCTCTTGGCTATAGCCAGCCTCCTCATTGAAGGGTGTTTTAGGGTATCTGCCCACAGATTTTC

TCCAAACAATTGGGAAGTGCCTAGAGTCCAGGCCCCGATCATCAAAGATGTCTATATTGTATAATATTTAAAGTTATTTTTAATTTTCTCAAACAATATG

AGAATATCTATCTGGCATTATCTATCTGCCAATCTCACTGTAATAAATTGATTATTTTGCCT
Translation
MGAWISRTRVPTPEPDPQEVLDLSRLPPELLLLVLSHVPPRTLLMHCRRVCRAWRALVDGQALWLLLLARDHSAAGRALLTLARRCLPPAHEDTPCPLGQ

FCALRPLGRNLISNPCGQG - UNI20178 - GLRKWMVRHGGDGWVVEKNRKPVPGAPSQTCFVTSFS SWCRKKQVVDLVEKGLWPELLDSGGVEIA

VSDW WWGARHDSGCKYRLFVTLLDAHQNVIDKFSAVPDPIEQWNNDIYLQ VTHVFSGIRRGIRFVSFEHWGQDTQFWAGHYGARVTNSSVIIRVCQS
Transcript ENSMUST00000039998
Sequence
GGATTTAGGGTCACTCCAAGTGTTGGATTGGTTGCTGAACCGCTAGGACTGTGCCAGAGCCCTGGCCTAATCTGTGTCCTCAGGTGGATTCCTAAACTGT

CCACCAGTCCTAAGCCGGAAGGAG - UNI20178 - - UNI33041 - TCCCAGCCAAGCGGGGCGCGGGGACCATGGGTGCCTGGATATCCAGGAC

CCGGGTCCCGACGCCGGAGCCCGACCCCCAGGAGGTCCTGGACCTGAGCCGTCTGCCCCCGGAGCTGCTCCTGCTGGTACTGAGCCACGTGCCCCCGCGC

ACGCTGCTGATGCACTGCCGCCGAGTGTGCCGCGCCTGGCGCGCCCTGGTAGATGGCCAGGCCCTATGGTTGCTGCTGCTGGCCCGTGACCACAGCGCAG

CGGGCCGCGCCCTGCTGACACTAGCCCGCCGCTGTCTGCCCCCTGCCCACGAAGACACGCCCTGCCCGCTGGGCCAATTCTGCGCACTGAGACCGCTAGG

ACGCAACCTCATCAGCAACCCCTGTGGCCAAG - UNI20178 - GCCTGCGCAAATGGATGGTGCGGCACGGTGGGGATGGATGGGTGGTGGAGAAGA

ACAGGAAACCTGTACCTGGGGCCCCTTCACAGACCTGCTTCGTGACTTCCTTCAG CTGGTGTCGCAAGAAGCAGGTCGTGGACCTGGTGGAGAAGGGTC

TGTGGCCAGAGCTGCTGGACAGTGGTGGTGTGGAGATTGCTGTCTCTGACTG GTGGGGAGCTCGACATGACAGTGGCTGTAAGTACCGTCTCTTTGTCA

CGCTTCTTGATGCCCACCAGAACGTCATAGATAAGTTCTCCGCTGTGCCAGATCCCATTGAACAGTGGAACAATGATATCTACCTGCAG GTCACCCACG

TGTTCTCCGGCATCAGGAGGGGCATACGTTTTGTCTCTTTTGAACACTGGGGCCAGGACACACAGTTCTGGGCTGGCCACTATGGGGCCAGAGTGACGAA

CTCCAGTGTGATCATACGAGTCTGTCAGTCCTAGTCAAAAGGCCGCCATTTTGGCAAGACAATCTGAATGTGCCTTCCTGGAGCTGTCGGCTGGAATCCC

TCATGAGTCAAGTACTGTACCTCCCTGGCACATGAAACTCTGGGATCCAGTGAAGGGTCCTGCTTGGTCTTGTTTTCAGAGTCTGTAACATTGAAGCCCT

CCATCAGATCTACCTATTACTGCTGCTTTAGAGCATGAGTGCCTAGGTGCCTGGATGCATGTGTGCCCGGATGCATGGATGCCTGGGTTCCTAGATGCAT

AGATGCCTGGGTGCCTGGATGCATGGATGCCTGGGTGCCCGGATGCATGGATGCATGGGTGCCCGGATGCATGGGTGCATGCTGGTCTCAAGTCACAAGC

TGCCTCTATTTCAGTTCGCTCACCTCTTTGCCCTGTCCCCAGTATTGATCCCCCACCCTTTTTTGAGACAGGGCATCCCAGCTGGCGACAACCCTCCTTT

CTGCCTTTGACACTCATGTGCTGGGACTACAGGCACACACCAGTACCACTCAGTCTTGTGCAGTGCTGGGGATGAGCCCAGGGTTTCATGCATGCCAGCA

AACATTCTACTATCTGAGCAATGTCCCCAGTGTCCCCTCTGGTCATGTCCTGTTTCTGCCTCAGGGATTGTCTCTGTTCCTTCGCTGAGGCCCTCTACTT

AGGGCTGAACATAGGATTTATGGCTAGCAGAATTCCAGCTCCCTTGGGTAAGGAACCAAAGCTCTCTTGGCTATAGCCAGCCTCCTCATTGAAGGGTGTT

TTAGGGTATCTGCCCACAGATTTTCTCCAAACAATTGGGAAGTGCCTAGAGTCCAGGCCCCGATCATCAAAGATGTCTATATTGTATAATATTTAAAGTT

ATTTTTAATTTTCTCAAACAATATGAGAATATCTATCTGGCATTATCTATCTGCCAATCTCACTGTAATAAATTGATTATTTTGCC
Translation
 - UNI20178 - - UNI33041 - MGAWISRTRVPTPEPDPQEVLDLSRLPPELLLLVLSHVPPRTLLMHCRRVCRAWRALVDGQALWLLLLARDHS

AAGRALLTLARRCLPPAHEDTPCPLGQFCALRPLGRNLISNPCGQG - UNI20178 - GLRKWMVRHGGDGWVVEKNRKPVPGAPSQTCFVTSFS SW

CRKKQVVDLVEKGLWPELLDSGGVEIAVSDW WWGARHDSGCKYRLFVTLLDAHQNVIDKFSAVPDPIEQWNNDIYLQ VTHVFSGIRRGIRFVSFEHWG

QDTQFWAGHYGARVTNSSVIIRVCQS

For any suggestions or comments, please send an email to unitrap@crg.es