Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037493 (Cib2)
Chromosomal location
Chr 9: 54392603 - 54407994 (-)
Description
calcium and integrin binding family member 2 Gene [Source:MGI (curated);Acc:Cib2-001]
RefSeq_dna
NM_019686 
RefSeq_peptide
NP_062660.1 
UniGene
Mm.42192 
MGI
MGI:1929293 
Uniprot/SWISSPROT
Q9Z309 
Uniprot/SPTREMBL
Q544Z8 
Human Ortholog
ENSG00000136425 (CIB2)
Omim not available
UniTrap UNI27012
Vector Insertion
Chr 9: 54397700 - 54402293
Public Clones not available
Private Clones OST78916 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25200
Vector Insertion
Chr 9: 54393892 - 54396139
Public Clones not available
Private Clones OST191939 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041901
Sequence
GAACTGCGGGACCCAGCGGAGCGGGCCAGGCTAGGCTGGCGACGCTGCCCGCTCCCGGGCTGGCAAGGGCCGCGGGCACCGGGCTCGGGGCTCCAGACGC

CGCCGATGGGAAGCAGCACTCGAAAGGGCGAGAGACGACGCCGCGGCCACCCATACCATCGCGGTCACCATGGGGAACAAGCAGACCATCTTCACTGAAG

AGCAGCTGGACAACTACCAG GACTGCACTTTCTTCAATAAGAAGGACATCCTCAA - UNI27012 - GCTTCATGCACGGTTCTATGAGCTGGCTCC

CAACCTCGTCCCGATGGACTACAGGAAGAGTCCCATCGTCCATGTACCCATGAGCCTCATCATTCAGATGCCGGAGCTCCGG GAGAATCCCTTCAAAGA

GAGGATTGTGGAGGCTTTCTCCGAGGATGGCGAGGGGAACCTCACCTTCAATGACTTTGTGGACATGTTCTCTGTGCTCTGCGAATCAGCGCCTCGGGAG

CTCAAGGCAAACTATGCCTTCAAGATCTATG - UNI25200 - ACTTCAACACTGACAATTTCATCTGTAAAGAAGACTTAGAGATGACGCTGGCCCG

ACTCACCAAGTCTGAGTTGGAAGAGGATGAGGTAGTGCTTGTGTGTGACAAAGTCATTGAAGAGGCTGACCTGGATGGTGACGGCAAGCTGGGCTTTGCT

GACTTTGAGGACATGATCGCCAAGGCCCCTGATTTTCTCAG CACCTTCCACATTCGAATCTGAAGACACTGCCAAGGCCGTGGGGGCCTAGAGCTGCAT

CCTCTGGCCTGCTGTCTGTGCAGGTATGGTTTCCAAGTGCTCCAGGGAAGGAGCTGTGGCCTCTGGGGTTCTCACCCATGGACATTTCCTGTGGCCCTTT

CAGCAAAAAAATTAAAATAAAATAAAATAAAATAAAATAAAATAAAAATCTAACTGCAACAGGGTTGTGAAGAGCAGGACCCTTCCCTGGGCCCCCAGTG

GCCTACCCTCAAGACCTGTAGTTCCCCTGTGAGCCCTCTCACGCACCCCCTGCCCAGTCCTTTTCTCACCTAGGAGGGGGAGGTAGAAAAACCCACTGGG

AGAGGTGAGGCTGGATTTTCCGTGTGCTGGGCAGACACCCCAGCCACCCAGGGATGAGTGCAAAAACCAACCAAGCAAAGAAAACAGAAAACAGAAAACA

GAACCTGGGGCTTTAACAAGCTATGCAATCTTTTACCAAAGCCAAGGCTGGGCTGTACCACCTCCGCCCCCGTACTTTCCCAATGTGAAGCTGTATAAGG

TTCGGTCCAAAGGGCTCTGCCCCTGTGTCTTGAACACTACCCCACCCCACCTCCCTGATGACATGGTATCACTTATGTGTGCTGACCTCAGATTTGTGAA

CTCCTAGAAATAAAACACTTTTTGTGTGCTG
Translation
MGNKQTIFTEEQLDNYQ DCTFFNKKDILK - UNI27012 - KLHARFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELR ENPFKERIVEAFSEDGE

GNLTFNDFVDMFSVLCESAPRELKANYAFKIYD - UNI25200 - DFNTDNFICKEDLEMTLARLTKSELEEDEVVLVCDKVIEEADLDGDGKLGFAD

FEDMIAKAPDFLS STFHIRI

For any suggestions or comments, please send an email to unitrap@crg.es