Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037513 (Samd4b)
Chromosomal location
Chr 7: 29185319 - 29208857 (-)
Description
sterile alpha motif domain containing 4B Gene [Source:MGI Symbol;Acc:MGI:2448542]
RefSeq_dna
NM_175021 
RefSeq_peptide
NP_778186.1 
UniGene
Mm.54120 Mm.393425 Mm.407408 
MGI
MGI:2448542 
Uniprot/SWISSPROT
Q80XS6 
Human Ortholog
ENSG00000179134 (SAMD4B)
Omim not available
UniTrap UNI6870
Vector Insertion
Chr 7: 29199362 - 29208454
Public Clones (sanger) BGA578 (baygenomics) E052E11 (ggtc) D032D05 (ggtc) D184H08 (ggtc)
D150E11 (ggtc) IST11636D4 (tigm) IST14892D3 (tigm) IST12455E12 (tigm)
IST11781D11 (tigm)
Private Clones OST466363 (lexicon) OST454964 (lexicon) OST422698 (lexicon) OST355911 (lexicon)
OST299932 (lexicon) OST260737 (lexicon) OST176521 (lexicon) OST66302 (lexicon)
OST58684 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28114
Vector Insertion
Chr 7: 29193195 - 29198890
Public Clones not available
Private Clones OST39636 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6776
Vector Insertion
Chr 7: 29191059 - 29191387
Public Clones YHA339 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1656
Vector Insertion
Chr 7: 29186927 - 29188638
Public Clones DA0058 (sanger) YTC556 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040531
Sequence
GGAGCCTGGAGAGGTGTGGCTGGACCAAGACCTCCCCTGATGTAAGCAGGCTCCCTCCTCCCCCCACCACCCGTTGCCACCACGCCAGGGGACATCCTCA

AGCCCTGGCCCTTAGGGGAGAGGTAACAGGAGCCCAGAGCCGAGACCATGTGACGGCGCTGGCCCTTGCCACCGCCGTCCCCCAACCCTGGCCCCAGGCC

TGGCACCATGATGTTCCGAGACCAAGTGGGCATCCTCGCTAGCTGGTTCAAGGGCTGGAATGAGTGTGAACAGACAGTGGCCCTGCTGTCCCTTCTGAAG

CGGGTCACCCGTACCCAAGCCCGCTTTCTGCAGCTCTGCCTGGAGCACTCGCTGGCGGACTGCAATGATATCCACCTGCTGGAGTCAGAGGCCAACAGTG

CTG - UNI6870 - CCATCGTCAGCCAGTGGCAACAGGAGTCCAAAGAGAAGGTGGTGTCCCTCCTGCTGTCCCATCTGCCCCTGCTCCAGCCAGGCA

ACACGGAGGCCAAGTCCGAGTACATGAGACTGCTGCAGAAAGTGCTGGCCTACTCCATCGAGAGCAATGCCTTCATTGAGGAGAGCCGCCAACTCCTCTC

CTATGCCCTCATCCACCCAGCCACCACACTGGAGGACCGCAATGCGCTAGCCCTCTGGCTGAGCCACCTGGAAGAGCGGCTAGCTAGTGGTTTCCGCACC

CGGCCAGAGCCCTCCTACCATTCACGCCAGGGCTCAGATGAATGGGGTGGACCTGCAGAGCTGGCCCCTGGAGAGGCAGGGCCAGGCTGGCAGGACAAGC

CACCCAGGGAAAATGGACACGTACCCTTCCACCCATCCAGCTCTGTGCCGCCGGCCATCAACAGTATTGGGAGCAATGCAAACACAG - UNI28114 -

 GTCTCCCCTGCCAAATCCACCCTAGCCCACTGAAGCGCTCCATGTCACTCATCCCTACGAGCCCACAGGCCCCTGGTGAGTGGCCGAGTCCAGAGGAGC

TTGGGGCCCGGGCTGCTTTCACCACGCCCGACCACGCACCCCTCTCGCCACAGAGCAGTGTGGCCTCCTCTGGCAGTGAGCAGACGGAGGAGCAGGGCTC

CAGCCGGAACACTTTCCAGGAGGATGGCAGCGGGATGAAAG ATGTGCCCTCATGGCTCAAGAGCCTCCGCTTGCACAAGTATGCTGCTCTGTTCTCACA

GATGAGCTACGAAGAGATGATGACCCTCACTGAGCAGCACCTAGAGTCGCAG AATGTCACCAAAGGTGCCCGGCACAAGATAGCCCTGAGCATCCAAAA

GCTGCGGGAGAGACAGAGCGTCCTCAAGTCCCTAGAGAAG GATGTGCTGGAAGGTGGCAATCTGCGGAATGCTCTGCAGGAACTGCAGCAGATCATCAT

CACTCCTATCAAGGCCTACAGTGTCCTTCAGGCCACCCCTACTGCCAAGGATGAGGGTCGGGGGGAGCCGCTGCTGCCAGGTGCTGAGCCTCCCCTCACC

CACCCTGGATCAGACAAGGGCACTGAGGCCAAGGACCCTCCAGCTGCAGAGAACTATCCTCCTCCACCAGCTCCAGCCCCCTCTGATAGCAGTGAGCCAG

CCCCAGCTCCCGTCGCCGACGGAGACATCCCCAGCCAGTTTACACGGGTGATGGGCAAAG - UNI6776 - TATGCACCCAGCTGCTGGTGTCCCGAC

CAGACGAGGAGAACATCACCAGTTACCTCCAGCTCATCGAAAAGTGCCTGACTCATGAG GCTTTCACAGAGACACAGAAGAAGCGGTTGCTGTCCTGGA

AGCAGCAAGTGCTGAAACTCCTCCGGACATTCCCTCGAAAAGCTGCACTGGACATGCAGAGCTACCGGCAGCAGAAGGG CTGGGCATTTGGCTCCAACT

CGCTCCCCATAGCTGGCTCTGTGGGGATGGGTGTTGCCCGGCGGACCCAGCGGCAGTTCCCAATGCCTCCTCGGGCATTACCACCTGGCAGGATGGGCCT

CCTGAGCCCTTCAGGCATTGGGGGTGTCTCTCCTCGACATGCCCTTACCAGCCCCAGTCTTGGGGGTCAGGGCCGACAG AACCTGTGGTTTGCCAATCC

TGGAGGCAGCAACAGCATGCCCAGCCAGAGCCGCAGCTCTGTGCAGCGCACTCACTCGCTCCCAGTTCACTCGTCACCCCAGGCTATTCTCATGTTCCCT

CCAG - UNI1656 - ACTGCCCGGTACCTGGGCCTGACCTGGAGATCAATCCTACCCTGGAGTCTCTGTGTCTGAGCATGACAGAACACGCCTTGGGT

G ATGGGACAGACAAAACCTCCACCATCTGACGGGACCCACAGCCCAGCGCACCCATAGGCTCCCTGGGCGGCGGGCGGGGGCCATCCCCCAACAGGCTT

CTCCTCAGCAGCGAGAGGGTGGGCTGGCGCAGCTATACATTCTGATATTTTTCTACTCATCCTCTTAACTTTTGTTTAACATTGGCACACGCCTTGCTCA

CTCCCAGGCCCATTGAGGGATCTCAGCTGAGGCCAGGGACAGAGAGGGCAGCCAGAGGCAAGGACTGGCCAGACTGCCTGCCTTTTCCCTCCCAAATCCC

CCACTAGCCCCATCCTACCCCTGCCTCCTTCAGACTGCTGACACCTGTCCTTCCCCAAGAGAGCAGACTTCCTCAGAGACAAACTGACAGTCACCTTGCG

CAACCTGCCCTTCAGACACATGACAGTGGGGGAATGAGCAGTGTGGACAGCCTGCTCCACCAGTATGTCACTGGAAAAGAGCCCCTCTCCCTTACCTCCT

ACCTTTCATCATTCCTACCATTCCTGAAGACAGGCACCACCTTCCTCCTTTTTTTCTTACCCTGTTTATCAGAGGTTCTCTACAATTAATTTCTTAGGCC

TATTTAAGATACATATTTATATAGTTCTTAACGGTTTTTCTCTGATCATTCCCTGTCATTTTTAGAATCCCTAGGCCTCTCTCTGAGCCAGGACAGTGGC

AGGGGGGGCCTGAACTTTATGAGGAGAGGGCAGAGCCCCCTCCTGCAGACCCTCTTGCCCTTCCCCATCCCAGCCCCGGCTCCCAGATGCAGAGGTTGAA

GGTGGGCAGCCCCAGGCCCTCAGTGAGGTCAGGAAGTCTGTTGCCTTAATGTCCCTTTCCCCCCACCAACATAACCCTTCTCTGTTCCCCAGGTCTGTGC

AAGACTTGAGGGTAGGAACCAGGGAATGGGGGGTGTTGGGTTTTTGTTTTCTTGCCTACCCTCTCTGTCAAACTTTCCCACCCCCATTATGTCATGACCT

CATGTAAGTGGAACACTATATCATAACCCAGAGGTGCAGCCCAGCCTGAGTCACATAAACCCTCTACTCCCTGTTCTTGATGAGGGCTGGTGCTGGGGCC

CAGGTGGAGGGAGGGAATTTGGGATTCAGGCTGTGGGGAAGCCAGGGTCCCCTATTCCAAACTCCTCTTTCCCCTCAACCTACACCCTCATTGGGACATT

CTCAAGCTTTTCACACGAAAAGGAAAAAAATGTTATTTTTAGATACATTTTATGAATAACTTTTGTTATGAATATGGCTGGTAACCATTGTGTATGTTAT

TAAAGATACAAAATGTTGGG
Translation
MMFRDQVGILASWFKGWNECEQTVALLSLLKRVTRTQARFLQLCLEHSLADCNDIHLLESEANSAA - UNI6870 - AIVSQWQQESKEKVVSLLLSH

LPLLQPGNTEAKSEYMRLLQKVLAYSIESNAFIEESRQLLSYALIHPATTLEDRNALALWLSHLEERLASGFRTRPEPSYHSRQGSDEWGGPAELAPGEA

GPGWQDKPPRENGHVPFHPSSSVPPAINSIGSNANTG - UNI28114 - GLPCQIHPSPLKRSMSLIPTSPQAPGEWPSPEELGARAAFTTPDHAPLS

PQSSVASSGSEQTEEQGSSRNTFQEDGSGMKD DVPSWLKSLRLHKYAALFSQMSYEEMMTLTEQHLESQ NVTKGARHKIALSIQKLRERQSVLKSLEK

 DVLEGGNLRNALQELQQIIITPIKAYSVLQATPTAKDEGRGEPLLPGAEPPLTHPGSDKGTEAKDPPAAENYPPPPAPAPSDSSEPAPAPVADGDIPSQ

FTRVMGKV - UNI6776 - VCTQLLVSRPDEENITSYLQLIEKCLTHE AFTETQKKRLLSWKQQVLKLLRTFPRKAALDMQSYRQQKG GWAFGSNS

LPIAGSVGMGVARRTQRQFPMPPRALPPGRMGLLSPSGIGGVSPRHALTSPSLGGQGRQ NLWFANPGGSNSMPSQSRSSVQRTHSLPVHSSPQAILMFP

PD - UNI1656 - DCPVPGPDLEINPTLESLCLSMTEHALGD DGTDKTSTI

For any suggestions or comments, please send an email to unitrap@crg.es