Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037514 (Pank2)
Chromosomal location
Chr 2: 131088236 - 131122427 (+)
Description
pantothenate kinase 2 (Hallervorden-Spatz syndrome) Gene [Source:MGI (curated);Acc:Pank2-001]
RefSeq_dna
NM_153501 
RefSeq_peptide
NP_705721.2 
UniGene
Mm.401821 
MGI
MGI:1921700 
Uniprot/SPTREMBL
Q3U4S0 Q7M753 A2AND1 Q3TIG7 
Human Ortholog
ENSG00000125779 (PANK2)
Omim 234200 - NEURODEGENERATION WITH BRAIN IRON ACCUMULATION 1  607236 - HYPOPREBETALIPOPROTEINEMIA, ACANTHOCYTOSIS, RETINITIS PIGMENTOSA,  
UniTrap UNI5257
Vector Insertion
Chr 2: 131088552 - 131098916
Public Clones YTA478 (baygenomics) YHD123 (baygenomics) SYA153 (baygenomics) YTA317 (baygenomics)
(ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19997
Vector Insertion
Chr 2: 131099646 - 131099716
Public Clones not available
Private Clones OST375408 (lexicon) OST327099 (lexicon) OST286631 (lexicon) OST276430 (lexicon)
OST275543 (lexicon) OST108281 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26605
Vector Insertion
Chr 2: 131099720 - 131100000
Public Clones not available
Private Clones OST108285 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29327
Vector Insertion
Chr 2: 131122008 - 131122060
Public Clones E13 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041233
Sequence
AGCGGGCTGCGCGGAGGCGGCAAGGCGGCGCTGGGGGGCTGGCTCGGGCGGCAGCGGCGGCTGTTGCGGATGGGAGCGGGCCGGTTTGGCGCGCCTATGG

AGCGCCAGGGCAGGGCTGCCGCCACCTCAGCCGCGGTCGGCGAGTCTGCGGACTCGGAAGCGCGGAGGCGGGACCCGCTGAGGCGCCGGGCGAGTAGCGC

GGCGCCGTCGGGGTCCGGGGAGGCGGAGAGTGTGAGACGGGAGCGGCCCGGCTCTCTAGGCGGCTCCACCTCGGCCGGCCGCCCGCGCGCCGAAGGCCTC

CGGAAGAGGCGGCCGC - UNI5257 - - UNI19997 - TTTTTCCATGGTTTGGCTTGGATATTGGAGGAACCTTGGTCAAGCTGGTTTATTTTGA

ACCTAAAGACATCACTGCTGAAGAAGAAAAGGAGGAAGTGGAGAGTCTGAAAAGCATCCGGAAGTACCTGACCTCCAATGTGGCTTACGGATCCACAGGC

ATTCGGGACGTGCACCTTGAGCTGAAGGACCTGACTCTGTGTGGACGCAAAGGCAATCTGCACTTTATACGCTTTCCCACCCATGACATGCCTGCTTTTA

TTCAGATGGGCAGAGATAAAAACTTCTCAAGTCTCCACACTGTCTTTTGTGCCACTGGAGGTGGATCATACAAATTTGAGCAGGATTTTCTCACA - UN

I26605 - ATAGGTGACCTTCAGCTTCGAAAACTGGATGAACTAGATTGCTTAATAAAAGGAATTTTATACATTGACTCAGTTGGATTCAATGGACGGT

CACAGTGCTATTATTTTGAAAACCCTGCTGATTCTGAAAAATGTCAGAAGTTACCATTTGATTTAAAAAATCCATATCCTCTGCTTCTGGTGAACATCGG

CTCAGGGGTTAGCATCTTAGCAGTGTATTCCAAAGATAATTATAAGAGGGTCACAGGCACCAG TCTTGGAGGAGGAACTTTCTTTGGTCTCTGCTGTCT

TCTTACTGGCTGTAGTACTTTTGAAGAAGCTCTTGAGATGGCATCTCGTGGAGATAGCACCAAAGTGGACAAATTAGTTCGAGACATTTATGGAGGAGAC

TATGAGAGGTTTGGCTTGCCAGGCTGGGCTGTGGCTTCAAG TTTTGGAAACATGATGAGCAAGGAGAAGAGAGAGGCGGCCAGTAAGGAGGATCTTGCC

AGAGCAACTTTGATCACCATCACCAACAACATTGGCTCCATAGCAAGAATGTGTGCCCTTAATGAA AACATTAACCAGGTCGTATTTGTCGGCAATTTC

CTGAGAGTCAACACGATTGCTATGCGGCTTCTGGCGTATGCGCTGGATTACTGGTCCAAGGGGCAGCTGAAAGCACTGTTTTCCGAGCACGAG - UNI2

9327 - GGATATTTTGGAGCCGTTGGAGCACTCCTCGAGCTGTTGAAGATACCCTGACTTACCGAGAGGACTTCCTGAAACCTGCCACAGAGACATCTG

TGGATTTTTTTGTTTTGTTTTGTTAAGAGACTCAAGTTTTATGATCGTGTACTACTCAAATCAGAGCAAGAAACAAATGTATTTTTCTAAGACATCAAGA

TAAATTCTTAAAATTTTGTCTAAGGACACCCCATCCCACCCCCGTCTAGGCAGTATGAGGATTTGCTGTTTATAGGGTATTCTCAGGGCAGCGTTATTAA

CCCCTGAGGTGCTTTGGAATCCCAGCATCACCCACTTGGGCATACGTGGAGCTTTCTGGACTCCCACCAGCAGCTGACTGCTTGTCCTGTTGAAATGTAT

GTGAGAATCTAACCGCTTTCATCAGT
Translation
LGGWLGRQRRLLRMGAGRFGAPMERQGRAAATSAAVGESADSEARRRDPLRRRASSAAPSGSGEAESVRRERPGSLGGSTSAGRPRAEGLRKRRPL - U

NI5257 - - UNI19997 - LFPWFGLDIGGTLVKLVYFEPKDITAEEEKEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRF

PTHDMPAFIQMGRDKNFSSLHTVFCATGGGSYKFEQDFLT - UNI26605 - IGDLQLRKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQ

KLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTS SLGGGTFFGLCCLLTGCSTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASS

 SFGNMMSKEKREAASKEDLARATLITITNNIGSIARMCALNE NINQVVFVGNFLRVNTIAMRLLAYALDYWSKGQLKALFSEHE - UNI29327 - 

GYFGAVGALLELLKIP
Transcript ENSMUST00000103185
Sequence
AGCGGGCTGCGCGGAGGCGGCAAGGCGGCGCTGGGGGGCTGGCTCGGGCGGCAGCGGCGGCTGTTGCGGATGGGAGCGGGCCGGTTTGGCGCGCCTATGG

AGCGCCAGGGCAGGGCTGCCGCCACCTCAGCCGCGGTCGGCGAGTCTGCGGACTCGGAAGCGCGGAGGCGGGACCCGCTGAGGCGCCGGGCGAGTAGCGC

GGCGCCGTCGGGGTCCGGGGAGGCGGAGAGTGTGAGACGGGAGCGGCCCGGCTCTCTAGGCGGCTCCACCTCGGCCGGCCGCCCGCGCGCCGAAGGCCTC

CGGAAGAGGCGGCCGC - UNI5257 - - UNI19997 - TTTTTCCATGGTTTGGCTTGGATATTGGAGGAACCTTGGTCAAGCTGGTTTATTTTGA

ACCTAAAGACATCACTGCTGAAGAAGAAAAGGAGGAAGTGGAGAGTCTGAAAAGCATCCGGAAGTACCTGACCTCCAATGTGGCTTACGGATCCACAGGC

ATTCGGGACGTGCACCTTGAGCTGAAGGACCTGACTCTGTGTGGACGCAAAGGCAATCTGCACTTTATACGCTTTCCCACCCATGACATGCCTGCTTTTA

TTCAGATGGGCAGAGATAAAAACTTCTCAAGTCTCCACACTGTCTTTTGTGCCACTGGAGGTGGATCATACAAATTTGAGCAGGATTTTCTCACA - UN

I26605 - ATAGGTGACCTTCAGCTTCGAAAACTGGATGAACTAGATTGCTTAATAAAAGGAATTTTATACATTGACTCAGTTGGATTCAATGGACGGT

CACAGTGCTATTATTTTGAAAACCCTGCTGATTCTGAAAAATGTCAGAAGTTACCATTTGATTTAAAAAATCCATATCCTCTGCTTCTGGTGAACATCGG

CTCAGGGGTTAGCATCTTAGCAGTGTATTCCAAAGATAATTATAAGAGGGTCACAGGCACCAG TCTTGGAGGAGGAACTTTCTTTGGTCTCTGCTGTCT

TCTTACTGGCTGTAGTACTTTTGAAGAAGCTCTTGAGATGGCATCTCGTGGAGATAGCACCAAAGTGGACAAATTAGTTCGAGACATTTATGGAGGAGAC

TATGAGAGGTTTGGCTTGCCAGGCTGGGCTGTGGCTTCAAG TTTTGGAAACATGATGAGCAAGGAGAAGAGAGAGGCGGCCAGTAAGGAGGATCTTGCC

AGAGCAACTTTGATCACCATCACCAACAACATTGGCTCCATAGCAAGAATGTGTGCCCTTAATGAA AACATTAACCAGGTCGTATTTGTCGGCAATTTC

CTGAGAGTCAACACGATTGCTATGCGGCTTCTGGCGTATGCGCTGGATTACTGGTCCAAGGGGCAGCTGAAAGCACTGTTTTCCGAGCACGAG - UNI2

9327 - GGATATTTTGGAGCCGTTGGAGCACTCCTCGAGCTGTTGAAGATACCCTGACTTACCGAGAGGACTTCCTGAAACCTGCCACAGAGACATCTG

TGGATTTTTTTGTTTTGTTTTGTTAAGAGACTCAAGTTTTATGATCGTGTACTACTCAAATCAGAGCAAGAAACAAATGTATTTTTCTAAGACATCAAGA

TAAATTCTTAAAATTTTGTCTAAGGACACCCCATCCCACCCCCGTCTAGGCAGTATGAGGATTTGCTGTTTATAGGGTATTCTCAGGGCAGCGTTATTAA

CCCCTGAGGTGCTTTGGAATCCCAGCATCACCCACTTGGGCATACGTGGAGCTTTCTGGACTCCCACCAGCAGCTGACTGCTTGTCCTGTTGAAATGTAT

GTGAGAATCTAACCGCTTTCATCAGT
Translation
MGAGRFGAPMERQGRAAATSAAVGESADSEARRRDPLRRRASSAAPSGSGEAESVRRERPGSLGGSTSAGRPRAEGLRKRRPL - UNI5257 - - UN

I19997 - LFPWFGLDIGGTLVKLVYFEPKDITAEEEKEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGR

DKNFSSLHTVFCATGGGSYKFEQDFLT - UNI26605 - IGDLQLRKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLL

LVNIGSGVSILAVYSKDNYKRVTGTS SLGGGTFFGLCCLLTGCSTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASS SFGNMMSKEKRE

AASKEDLARATLITITNNIGSIARMCALNE NINQVVFVGNFLRVNTIAMRLLAYALDYWSKGQLKALFSEHE - UNI29327 - GYFGAVGALLELL

KIP
Transcript ENSMUST00000110195
Sequence
AGCGGGCTGCGCGGAGGCGGCAAGGCGGCGCTGGGGGGCTGGCTCGGGCGGCAGCGGCGGCTGTTGCGGATGGGAGCGGGCCGGTTTGGCGCGCCTATGG

AGCGCCAGGGCAGGGCTGCCGCCACCTCAGCCGCGGTCGGCGAGTCTGCGGACTCGGAAGCGCGGAGGCGGGACCCGCTGAGGCGCCGGGCGAGTAGCGC

GGCGCCGTCGGGGTCCGGGGAGGCGGAGAGTGTGAGACGGGAGCGGCCCGGCTCTCTAGGCGGCTCCACCTCGGCCGGCCGCCCGCGCGCCGAAGGCCTC

CGGAAGAGGCGGCCGC - UNI5257 - - UNI19997 - TTTTTCCATGGTTTGGCTTGGATATTGGAGGAACCTTGGTCAAGCTGGTTTATTTTGA

ACCTAAAGACATCACTGCTGAAGAAGAAAAGGAGGAAGTGGAGAGTCTGAAAAGCATCCGGAAGTACCTGACCTCCAATGTGGCTTACGGATCCACAGGC

ATTCGGGACGTGCACCTTGAGCTGAAGGACCTGACTCTGTGTGGACGCAAAGGCAATCTGCACTTTATACGCTTTCCCACCCATGACATGCCTGCTTTTA

TTCAGATGGGCAGAGATAAAAACTTCTCAAGTCTCCACACTGTCTTTTGTGCCACTGGAGGTGGATCATACAAATTTGAGCAGGATTTTCTCACA - UN

I26605 - AACATTAACCAGGTCGTATTTGTCGGCAATTTCCTGAGAGTCAACACGATTGCTATGCGGCTTCTGGCGTATGCGCTGGATTACTGGTCCA

AGGGGCAGCTGAAAGCACTGTTTTCCGAGCACGAG - UNI29327 - GGATATTTTGGAGCCGTTGGAGCACTCCTCGAGCTGTTGAAGATACCCTGA

CTTACCGAGAGGACTTCCTGAAACCTGCCACAGAGACATCTGTGGATTTTTTTGTTTTGTTTTGTTAAGAGACTCAAGTTTTATGATCGTGTACTACTCA

AATCAGAGCAAGAAACAAATGTATTTTTCTAAGACATCAAGATAAATTCTTAAAATTTTGTCTAAGGACACCCCATCCCACCCCCGTCTAGGCAGTATGA

GGATTTGCTGTTTATAGGGTATTCTCAGGGCAGCGTTATTAACCCCTGAGGTGCTTTGGAATCCCAGCATCACCCACTTGGGCATACGTGGAGCTTTCTG

GACTCCCACCAGCAGCTGACTGCTTGTCCTGTTGAAATGTATGTGAGAATCTAACCGCTTTCATCAGT
Translation
MERQGRAAATSAAVGESADSEARRRDPLRRRASSAAPSGSGEAESVRRERPGSLGGSTSAGRPRAEGLRKRRPL - UNI5257 - - UNI19997 - 

LFPWFGLDIGGTLVKLVYFEPKDITAEEEKEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGRDKNFSSLHT

VFCATGGGSYKFEQDFLT - UNI26605 - NINQVVFVGNFLRVNTIAMRLLAYALDYWSKGQLKALFSEHE - UNI29327 - GYFGAVGALLEL

LKIP
Transcript ENSMUST00000079386
Sequence
GAGGGTATCAGATCCCCTGGAACT - UNI19997 - TTTTTCCATGGTTTGGCTTGGATATTGGAGGAACCTTGGTCAAGCTGGTTTATTTTGAACCT

AAAGACA - UNI19997 - - UNI26605 - GCTGAAGAAGAAAAGGAGGAAGTGGAGAGTCTGAAAAGCATCCGGAAGTACCTGACCTCCAATGTG

GCTTACGGATCCACAGGCATTCGGGACGTGCACCTTGAGCTGAAGGACCTGACTCTGTGTGGACGCAAAGGCAATCTGCACTTTATACGCTTTCCCACCC

ATGACATGCCTGCTTTTATTCAGATGGGCAGAGATAAAAACTTCTCAAGTCTCCACACTGTCTTTTGTGCCACTGGAGGTGGATCATACAAATTTGAGCA

GGATTTTCTCACA - UNI26605 - ATAGGTGACCTTCAGCTTCGAAAACTGGATGAACTAGATTGCTTAATAAAAGGAATTTTATACATTGACTCAG

TTGGATTCAATGGACGGTCACAGTGCTATTATTTTGAAAACCCTGCTGATTCTGAAAAATGTCAGAAGTTACCATTTGATTTAAAAAATCCATATCCTCT

GCTTCTGGTGAACATCGGCTCAGGGGTTAGCATCTTAGCAGTGTATTCCAAAGATAATTATAAGAGGGTCACAGGCACCAG TCTTGGAGGAGGAACTTT

CTTTGGTCTCTGCTGTCTTCTTACTGGCTGTAGTACTTTTGAAGAAGCTCTTGAGATGGCATCTCGTGGAGATAGCACCAAAGTGGACAAATTAGTTCGA

GACATTTATGGAGGAGACTATGAGAGGTTTGGCTTGCCAGGCTGGGCTGTGGCTTCAAG TTTTGGAAACATGATGAGCAAGGAGAAGAGAGAGGCGGCC

AGTAAGGAGGATCTTGCCAGAGCAACTTTGATCACCATCACCAACAACATTGGCTCCATAGCAAGAATGTGTGCCCTTAATGAA AACATTAACCAGGTC

GTATTTGTCGGCAATTTCCTGAGAGTCAACACGATTGCTATGCGGCTTCTGGCGTATGCGCTGGATTACTGGTCCAAGGGGCAGCTGAAAGCACTGTTTT

CCGAGCACGAG - UNI29327 - GGATATTTTGGAGCCGTTGGAGCACTCCTCGAGCTGTTGAAGATACCCTGA
Translation
EGIRSPGT - UNI19997 - FFHGLAWILEEPWSSWFILNLKT - UNI19997 - - UNI26605 - AEEEKEEVESLKSIRKYLTSNVAYGSTG

IRDVHLELKDLTLCGRKGNLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGSYKFEQDFLT - UNI26605 - IGDLQLRKLDELDCLIKGILY

IDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTS SLGGGTFFGLCCLLTGCSTFEEALEMASRGDSTKV

DKLVRDIYGGDYERFGLPGWAVASS SFGNMMSKEKREAASKEDLARATLITITNNIGSIARMCALNE NINQVVFVGNFLRVNTIAMRLLAYALDYWSK

GQLKALFSEHE - UNI29327 - GYFGAVGALLELLKIP

For any suggestions or comments, please send an email to unitrap@crg.es