Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037523 (D430028G21Rik)
Chromosomal location
Chr 2: 131059803 - 131073761 (+)
Description
RIKEN cDNA D430028G21 gene Gene [Source:MGI Symbol;Acc:MGI:2444773]
RefSeq_dna
NM_144888 
RefSeq_peptide
NP_659137.1 
UniGene
Mm.287226 Mm.402894 
MGI
MGI:2444773 
Uniprot/SWISSPROT
Q8VCF0 
Uniprot/SPTREMBL
A2ANC9 Q3U5B1 
Human Ortholog
ENSG00000088888 (RP11-119B16.1)
Omim not available
UniTrap UNI32085
Vector Insertion
Chr 2: 131060092 - 131064471
Public Clones IST14181A7 (tigm) IST10454E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15142
Vector Insertion
Chr 2: 131066229 - 131067615
Public Clones PST12320-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5915
Vector Insertion
Chr 2: 131069009 - 131070938
Public Clones CSH141 (baygenomics) PST4480-NL (escells) PST4352-NL (escells) PST4352-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110199
Sequence
GTTGCCTAGTCTGGTTTCTCTTGGTAAGTTTGCAGCCTGGGCGTCGGTGCTCAGGACTCTGTGTTCACTGAGATCCTTCAGGGAGGGAACCTTGGCTAGG

GCCAGTTACGCCTGGGAGTCCGCATGGGCGCCCTGGGCCTGGGCGCGTGGGGTCGGAGAGGCTCCTGAACTAGGGGAGAATGAGGTCGGCCACACACGGA

TTCGCGACCCCGGCAGTTCCTTGATCCGCATCCAGCACCTTTAGCAAGCAG - UNI32085 - TCCATCTCAGTCCATCCCACCCTGCCAGGGTCCGA

GTCACTCCAGAAGCTGAGCAGCCATGACATTTGCTGAGGACAAGACCTATAAGTATATCCGAGACAACCACAGCAAGTTTTGCTGTGTTGACGTTCTGGA

GATCCTGCCTTACCTGTCCTGCCTCACAGCTAGTGACCAG GATCGACTGCGGGCTTCCTACAGGCAGATCGGGAACCGGGACACACTCTGGGGACTCTT

CAATAATCTCCAGCGCCGGCCTGGCTGGGTGGAGGTCTTCATCCGGGCACTGCAGATCTGTGAGCTGCCTGGGCTGGCTGATCAAGTGACTCGAGTTTAT

CAGAGCTACCTGCCTCCGG - UNI15142 - GGACCTCACTCCGCTCCCTAGAGCCACTGCAGTTACCAGACTTTCCTGCTGCGGTTTCTGGACCCTC

TGCATTTGCGCCAGGTCACAACATCCCTGACCATGGCTTACGAGAGACACCAAGTTGCCCCAAGCCTGTCCAGGACACCCAGCCACCAGAGTCCCCAGTA

GAG AATTCAGAGCAACTCCTCCAGACCAACTCCGGGGCCGTCGCGAGGATGTCTGGTGGCTCTTTGATACCCTCTCCTAACCAGCAGGCTCTCAGCCCT

CAGCCCTCCAGAGAGCATCAAGAGCAAGAACCAGAACTGGGTGGCGCCCACGCAGCAA - UNI5915 - ATGTTGCCTCTGTTCCCATAGCAACCTAT

GGACCTGTGTCTCCAACCGTTTCCTTCCAGCCCCTTCCACGTACTGCCCTGAGGACAAACCTCTTGTCTGGGGTCACAGTATCAGCCCTATCTGCTGATA

CCTCTTTGTCCTCCTCGTCCACTGGATCAGCTTTTGCAAAGGGAGCTGGTGACCAGGCCAAAGCTGCCACCTGTTTCAGTACTACACTCACCAATTCTGT

GACTACCAGCTCAGTGCCTTCTCCCAGATTGGTCCCAGTAAAAACCATGTCTTCCAAGTTGCCCCTCAGTTCAAAGTCCACTGCTGCGATGACGTCTACT

GTGCTCACCAATACAGCGCCATCAAAATTACCCAGCAACTCAGTGTATGCGGGCACAGTGCCATCCAGAGTGCCTGCTAGTGTGGCCAAAGCACCTGCCA

ACACAATACCACCTGAGAGGAACAGCAAGCAAGCCAAG GAGACCCCGGAGGGTCCAGCAACCAAAGTCACCACTGGAGGCAACCAGACTGGACCAAATA

GCAGTATCAGGAGCTTGCACTCTGGACCAGAGATGAGCAAGCCAGGTGTGCTGGTATCCCAGTTGGACGAGCCATTCTCAGCCTGCTCTGTGGACCTTGC

CATTAGCCCTAGCAGCTCCTTGGTCTCAGAACCCAACCATGGTCCAGAGGAGAATGAGTATTCGTCCTTTAGAATCCAGGTAGACGAAAGCCCCAGTGCT

GATCTATTAGGAAGCCCTGAGCCACTAGCCACCCAGCAGCCCCAAGAAGAGGAAGAACATTGTGCCAGTTCAATGCCCTGGGCTAAGTGGCTTGGGGCCA

CCAGTGCACTCTTGGCTGTATTCCTGGCAGTGATGCTGTACCGTAGTAGGCGCCTGGCCCAGTGAAGCCTCAGCTGTATGCTGTTCTCTTGCTCAGTTCT

GCCAAGCATGTTCTCTAGGCTTGGGCTAGTAGAGGCTGAGTCAGAGAAACTTAAATATGGCGAGGTCCACTGAGCTATCCAGGTAGATAGCTACACCAAG

ACGTCATCACTGTTGGGTGGGGGAGAGACATTGTTTTATCCTGGTTCATATGTCATCTTCTGGTCTTCAGCTTTTGGAGGCACTGTGTTACCTCCATTGC

TCCTGACCTGCCCACGTGGCAGTGTAAGAGTTCATGCTCTGTGCTCCTAAGGAGGTATCTCCACCAGCTTTATCCCTGTTGGCCCAAGCCTGAAGATGAG

GAGGTATCGCACTGTTGACAATGCCCCTCATCTCGCCCAGATCTTCTGAAACACAAGCGTAGGTACACTGATGAGTGCTCCCATAGCATCTTATGCCTTC

CACCGGCAGCCTGGTCTAAGGCCTTGGCAGGAGAGCCTGGGAGTAACAGAGTGGCTGGTCTCTAGGGAGCTTTGAGTGCTCTGCCCCTTTGGGCCCTCTC

CACAGCCAGTCAACCCTGAGGGTGAGTCTGGAGGTTCTCTGTGGACTCTTAAGAAAGCCAGAAGCAACTGCCAGGCCTGAGGAAGCCCCTGGGAGGGAGC

TTTTCTCCAACCTCCTTACCCCCTCCTCGCTTCTCCACTCCTGGTCTCCATTCTCTCCCTATACTGGATGATGAGATACCTAGTGGGCAGAACTCAGGCT

GGGCTTGCATCAGTTCCACCCTTTCCCTGGCCTTTAGCAGATGTCTAGCTTCTCTAGTCTTGTTCCCAATGTAGATAGCGGGCAGCTCTTCCTTTTACTG

GGCTCCTCTGAGTTTGAAGGATACAGATACTTGCCTAGTACTTATCTCAGAGGGTGTGAGTACAAGTTCTTGCCCTCCTGCCCTGGCTGGCTGAGCTAAG

GTGAGAGTGTGAGAGGCAGAGTGCATATTGGTAATGGCAGTCTTTGAGAGAGCAGCCTTCATCTCCATCATGCTTCTTTCTCCTCCCTGGTCAGGTGTAG

GCCTCACCTCTGTGCCTCACTTTTCTTACCTGTGAGATGGGGTGAGTATGTGTGTGTATACACACACATACCCACAGACCCACGCCCACACCCACACATA

CATGCTAATATATTCTCACCTGTGAGATGGAAAGTATGCATACATTGATGCTAATATATTCTAGTTTTATCAGGATAATTAAAAGAGTTTATCTGT
Translation
 - UNI32085 - MTFAEDKTYKYIRDNHSKFCCVDVLEILPYLSCLTASDQ DRLRASYRQIGNRDTLWGLFNNLQRRPGWVEVFIRALQICELPGLA

DQVTRVYQSYLPPG - UNI15142 - GTSLRSLEPLQLPDFPAAVSGPSAFAPGHNIPDHGLRETPSCPKPVQDTQPPESPVE NSEQLLQTNSGAVA

RMSGGSLIPSPNQQALSPQPSREHQEQEPELGGAHAAN - UNI5915 - NVASVPIATYGPVSPTVSFQPLPRTALRTNLLSGVTVSALSADTSLSSS

STGSAFAKGAGDQAKAATCFSTTLTNSVTTSSVPSPRLVPVKTMSSKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPANTIPPE

RNSKQAK ETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPSSSLVSEPNHGPEENEYSSFRIQVDESPSADLLGS

PEPLATQQPQEEEEHCASSMPWAKWLGATSALLAVFLAVMLYRSRRLAQ
Transcript ENSMUST00000041362
Sequence
ATCTGCGAGGGCTCTGCACAGTCGAACGCGGTCAACCTGTTGCCTAGTCTGGTTTCTCTTG - UNI32085 - TCCATCTCAGTCCATCCCACCCTGC

CAGGGTCCGAGTCACTCCAGAAGCTGAGCAGCCATGACATTTGCTGAGGACAAGACCTATAAGTATATCCGAGACAACCACAGCAAGTTTTGCTGTGTTG

ACGTTCTGGAGATCCTGCCTTACCTGTCCTGCCTCACAGCTAGTGACCAG GATCGACTGCGGGCTTCCTACAGGCAGATCGGGAACCGGGACACACTCT

GGGGACTCTTCAATAATCTCCAGCGCCGGCCTGGCTGGGTGGAGGTCTTCATCCGGGCACTGCAGATCTGTGAGCTGCCTGGGCTGGCTGATCAAGTGAC

TCGAGTTTATCAGAGCTACCTGCCTCCGG - UNI15142 - GGACCTCACTCCGCTCCCTAGAGCCACTGCAGTTACCAGACTTTCCTGCTGCGGTTT

CTGGACCCTCTGCATTTGCGCCAGGTCACAACATCCCTGACCATGGCTTACGAGAGACACCAAGTTGCCCCAAGCCTGTCCAGGACACCCAGCCACCAGA

GTCCCCAGTAGAG AATTCAGAGCAACTCCTCCAGACCAACTCCGGGGCCGTCGCGAGGATGTCTGGTGGCTCTTTGATACCCTCTCCTAACCAGCAGGC

TCTCAGCCCTCAGCCCTCCAGAGAGCATCAAGAGCAAGAACCAGAACTGGGTGGCGCCCACGCAGCAA - UNI5915 - ATGTTGCCTCTGTTCCCAT

AGCAACCTATGGACCTGTGTCTCCAACCGTTTCCTTCCAGCCCCTTCCACGTACTGCCCTGAGGACAAACCTCTTGTCTGGGGTCACAGTATCAGCCCTA

TCTGCTGATACCTCTTTGTCCTCCTCGTCCACTGGATCAGCTTTTGCAAAGGGAGCTGGTGACCAGGCCAAAGCTGCCACCTGTTTCAGTACTACACTCA

CCAATTCTGTGACTACCAGCTCAGTGCCTTCTCCCAGATTGGTCCCAGTAAAAACCATGTCTTCCAAGTTGCCCCTCAGTTCAAAGTCCACTGCTGCGAT

GACGTCTACTGTGCTCACCAATACAGCGCCATCAAAATTACCCAGCAACTCAGTGTATGCGGGCACAGTGCCATCCAGAGTGCCTGCTAGTGTGGCCAAA

GCACCTGCCAACACAATACCACCTGAGAGGAACAGCAAGCAAGCCAAG GAGACCCCGGAGGGTCCAGCAACCAAAGTCACCACTGGAGGCAACCAGACT

GGACCAAATAGCAGTATCAGGAGCTTGCACTCTGGACCAGAGATGAGCAAGCCAGGTGTGCTGGTATCCCAGTTGGACGAGCCATTCTCAGCCTGCTCTG

TGGACCTTGCCATTAGCCCTAGCAGCTCCTTGGTCTCAGAACCCAACCATGGTCCAGAGGAGAATGAGTATTCGTCCTTTAGAATCCAGGTAGACGAAAG

CCCCAGTGCTGATCTATTAGGAAGCCCTGAGCCACTAGCCACCCAGCAGCCCCAAGAAGAGGAAGAACATTGTGCCAGTTCAATGCCCTGGGCTAAGTGG

CTTGGGGCCACCAGTGCACTCTTGGCTGTATTCCTGGCAGTGATGCTGTACCGTAGTAGGCGCCTGGCCCAGTGAAGCCTCAGCTGTATGCTGTTCTCTT

GCTCAGTTCTGCCAAGCATGTTCTCTAGGCTTGGGCTAGTAGAGGCTGAGTCAGAGAAACTTAAATATGGCGAGGTCCACTGAGCTATCCAGGTAGATAG

CTACACCAAGACGTCATCACTGTTGGGTGGGGGAGAGACATTGTTTTATCCTGGTTCATATGTCATCTTCTGGTCTTCAGCTTTTGGAGGCACTGTGTTA

CCTCCATTGCTCCTGACCTGCCCACGTGGCAGTGTAAGAGTTCATGCTCTGTGCTCCTAAGGAGGTATCTCCACCAGCTTTATCCCTGTTGGCCCAAGCC

TGAAGATGAGGAGGTATCGCACTGTTGACAATGCCCCTCATCTCGCCCAGATCTTCTGAAACACAAGCGTAGGTACACTGATGAGTGCTCCCATAGCATC

TTATGCCTTCCACCGGCAGCCTGGTCTAAGGCCTTGGCAGGAGAGCCTGGGAGTAACAGAGTGGCTGGTCTCTAGGGAGCTTTGAGTGCTCTGCCCCTTT

GGGCCCTCTCCACAGCCAGTCAACCCTGAGGGTGAGTCTGGAGGTTCTCTGTGGACTCTTAAGAAAGCCAGAAGCAACTGCCAGGCCTGAGGAAGCCCCT

GGGAGGGAGCTTTTCTCCAACCTCCTTACCCCCTCCTCGCTTCTCCACTCCTGGTCTCCATTCTCTCCCTATACTGGATGATGAGATACCTAGTGGGCAG

AACTCAGGCTGGGCTTGCATCAGTTCCACCCTTTCCCTGGCCTTTAGCAGATGTCTAGCTTCTCTAGTCTTGTTCCCAATGTAGATAGCGGGCAGCTCTT

CCTTTTACTGGGCTCCTCTGAGTTTGAAGGATACAGATACTTGCCTAGTACTTATCTCAGAGGGTGTGAGTACAAGTTCTTGCCCTCCTGCCCTGGCTGG

CTGAGCTAAGGTGAGAGTGTGAGAGGCAGAGTGCATATTGGTAATGGCAGTCTTTGAGAGAGCAGCCTTCATCTCCATCATGCTTCTTTCTCCTCCCTGG

TCAGGTGTAGGCCTCACCTCTGTGCCTCACTTTTCTTACCTGTGAGATGGGGTGAGTATGTGTGTGTATACACACACATACCCACAGACCCACGCCCACA

CCCACACATACATGCTAATATATTCTCACCTGTGAGATGGAAAGTATGCATACATTGATGCTAATATATTCTAGTTTTATCAGGATAATTAAAAGAGTTT

ATCTGTGCAAA
Translation
 - UNI32085 - MTFAEDKTYKYIRDNHSKFCCVDVLEILPYLSCLTASDQ DRLRASYRQIGNRDTLWGLFNNLQRRPGWVEVFIRALQICELPGLA

DQVTRVYQSYLPPG - UNI15142 - GTSLRSLEPLQLPDFPAAVSGPSAFAPGHNIPDHGLRETPSCPKPVQDTQPPESPVE NSEQLLQTNSGAVA

RMSGGSLIPSPNQQALSPQPSREHQEQEPELGGAHAAN - UNI5915 - NVASVPIATYGPVSPTVSFQPLPRTALRTNLLSGVTVSALSADTSLSSS

STGSAFAKGAGDQAKAATCFSTTLTNSVTTSSVPSPRLVPVKTMSSKLPLSSKSTAAMTSTVLTNTAPSKLPSNSVYAGTVPSRVPASVAKAPANTIPPE

RNSKQAK ETPEGPATKVTTGGNQTGPNSSIRSLHSGPEMSKPGVLVSQLDEPFSACSVDLAISPSSSLVSEPNHGPEENEYSSFRIQVDESPSADLLGS

PEPLATQQPQEEEEHCASSMPWAKWLGATSALLAVFLAVMLYRSRRLAQ

For any suggestions or comments, please send an email to unitrap@crg.es