Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037526 (D14Ertd436e)
Chromosomal location
Chr 14: 48160569 - 48188089 (-)
Description
Uncharacterized protein KIAA0831  [Source:UniProtKB/Swiss-Prot;Acc:Q8CDJ3]
RefSeq_dna
NM_172599 
RefSeq_peptide
NP_766187.1 
UniGene
Mm.287279 Mm.470462 
MGI
MGI:1261775 
Uniprot/SWISSPROT
Q8CDJ3 
Human Ortholog
ENSG00000126775 (KIAA0831)
Omim not available
UniTrap UNI36020
Vector Insertion
Chr 14: 48180295 - 48188090
Public Clones IST14502B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6580
Vector Insertion
Chr 14: 48174317 - 48178848
Public Clones YHB207 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2742
Vector Insertion
Chr 14: 48167034 - 48168593
Public Clones AK0281 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042988
Sequence
AGATCATCATGGCGTCTCCCAGTGGGAAGGGATCTTGGACGCCCGAGGCTCCTGGTTTTGGGCCGCGGGCGCTAGCACGGGACCTGGTGGACTCGGTGGA

CGACGCCGAGGGCCTTTACGTGGCTGTTGAGCGGTGTCCTCTGTGCAACACCACTCGCCGGCGGTTGACTTGCGCCAAGTGCGTCCAGAGCGGTGATTTC

GTCTATTTCGACGGCCGCGACCGGGAGAG - UNI36020 - GTTTATTGACAAGAAGGAAAGACTAAGCCAACTTAAGAACAAGCAAGAAGAATTTCA

GAAAGA - UNI36020 - AGTACTAAAAGCTATGGAAGGAAAGCGGCTTACAGATCAGTTG - UNI6580 - AGATGGAAAATAATGTCATGCAAG

ATGAGGATTGAACAGCTGAAGCAAACAATATGTAAAGGAAATGAGGAAATGAAGAAAA ATTCTGAAGGTCTCCTCAAGAACAAGGAAAAGAACCAGAAG

CTTTACAGCCGAGCACAGCGGCACCAAGAGAAAAAGGAGAAGATTCAGCGGCACAACCGCAAGCTTGGGGACCTGGTGGAGAAGAAGACCATTGACTTGA

AGAGTCACTATGAGCGGTTGGCGCGGCTTCGAAGGTCACACATCCTAGAGCTCACCTCCATCATATTCCCAATCGACGAAGTGAAGACTTCTGGGAG AG

ACCCTGCAGACGTGTCTTCAGAGACTGACAGTGCCATGACCTCAAGCATGGTGAGCAAGCTTGCTGAGGCCCGGAGGACAACTTACCTCTCTGGAAGATG

GGTCTGTGATGACCACAATGGTGACACCAGCATTAGCATCACAGGCCCGTGGATTAGCCTACCAAACAACGGGGACTACTCTGCTTACTACAATTGGGTA

GAAGAGAAGAAAACAACCCAAGGACCTG - UNI2742 - ACATGGAGCATAACAACCCCGCCTACACTATCAGCGCCGCGCTGGGCTACGCCACGCAG

CTCGTCAACATTGTGTCTCACATACTTGACATCAATCTTCCCAAAAAGCTGTGCAACAG CGAGTTCTGTGGCGAAAACCTCAGCAAGCAGAAACTGACA

CGCGCAGTGAGGAAACTGAACGCAAACATCCTTTACCTTTGTTCTTCTCAG CATGTAAATCTGGATCAGTTGCAACCACTGCACACACTCAGGAACCTG

ATGCACTTGGTCAGCCCGCGCTCTGAGCACCTAGGCAG GTCAGGACCCTTTGAAGTTCGAGCAGACCTCGAGGAGTCCATGGAATTTGTGGACCCTGGA

GTTGCTGGAGAATCAGACGCGAGTGGAGATGAGCGTGTAAGCGATGAGGAGACTGACCTGGGCACAGACTGGGAGAACCTGCCAAGCCCCCGATTCTGTG

ACATCCCTTCCCAGCCGGTGGAAGTGTCCCAGAGCCAGAGCACCCAGGTGTCCCCACCCATTGCCAGCAGCAGCGCTGGTGGGATGATCTCCTCCGCTGC

GGCCTCGGTGACCTCTTGGTTCAAAGCTTACACTGGACACCGCTAACGAGTTGGGACCAAAAATGCTGATTTTGTGTCTCAGAGTCTTTCCCACTGCACT

CTCATAACCTTGTCTGTGTAGTTGCGATAGAGCTTGGAAGCTATCGCCAGGACAAGATTAGTGTCAGGGCCTGAGCTCGGGGCTCCTGGGCCCAGGTCCT

CAGTATGCTGGTTCCTGGGTGCAGAGTCTCCCTGACACTAAGTCCTAGGCTTTGATCAGATCACAAAGAAGTGTTTCTTGGTAATGAGGAATGAAAGACA

AAGGCTGAGTTTGTTTTTCTGTCATCCTCTTGAGAGACCAGCCAGCAGGCCAGCAGCAGTTTGGCCTCATCCGGGAGAGGTGGTTGTCTGGGGAAGGAGG

AAATGAAAGCTTATTGCTTATTGCTTATTGTCAGTCATTGTGCGTCACATTCCTGATTTCCTACTACACACCAAAGAAACCAAATTCTTTATTTCTGTAG

ACCCATATCTGCGAATGGGGAGTCTGCTGGGATGGTTAGATGTCTAAACAGTTCTCTTGTATTCTGAAGGGAGATAAGTCATTGGGATTGTCTGTACTAC

ACTCACTTCCTCCATCATTCCCTGGATGGGCTAAATGCTACCCGAGCGTTGGCTGAACACTTACGTGGTCACTCGCTTGCTGTCCGGTTTCTTCCTTGGT

GGTGGTGGTGGGGTTAACTAGTAGCAGGTGTTTCCAGGGAACTCTTCCTTCTTGTTCCTGAGGTCTTCTTGTCCCTGGGGTCTCTGAGACTGAAGACAGC

ACCTTATGCAGAGTGTAGCGCGGAGCAGCTGTCCCAGGAAATGCTCAGCTATCAAGGGATTTCCTCAGAGGTCATTCTAATGACAATCTTATAGAAAGCT

ATAAAAAGAGAGGCATTATGTTCAAGTCATAAGGAGTTCTTTTTTTATTTTTAGTAACTTCAAAAAGGAAGTTCTGTGTAACAGACTCCTGCAGTCCTGT

GAGAAAGCACCCCCCTCCCCTGGCCTTGTCACCATATCCTCCTGTTGTGACTGGTGTGATGGTACCTCAGCCAGGTCCTTCAGCAGTCTGCCACGCCCTG

GCTTCTGTTGACTCACACTGTGGTTGGTACTTTGCCTGCAGATTGAGGTGCTGTGGCGCTTTGGCAGTTATTAGAAGTGTAGGAAGGACTTCATCCTGCC

CAGGTTCCCCACGTTCCCAAGCTCTAGATACCCAGCTGTGGAGCAGGCGGCTGGAGTCTGTTCTGTGCTCAGCTCTGCGACTGCTGGGCTCGTGTTTTAC

CACCTACTTCTAGGACTTACAGACTGAGTGCGCTGGGAGGAAGCTACAGAAAGTGCAGAGGCCACCAACTACCGCCTACAGCAATTTAACCACAGTTGCA

GAAAGCACAGGGCTGGGTGGCCTTGTTTTATTTCATATCAATCAGAGGCACTTTTGTCATCGTCCCTCACAGTAAGTGACCAGCACGGACTGCCTAGGCT

GCTCAAGTCCTTGGGGTTTTGTTATTTTGCACTGGATCCACCTGTTGTAAATAGTCTTAAATACACATTTCAACCACTGTTTGGTTCCTACACTCTTTGC

TGCTCATTAAAACTTTTTGTGTAGGTGTCAGAACCGTACACAAACAGCTTTCTAGAAAAAAAAAAATGAAGCTGGTGTTTTGTTTTTTTTTTTTAAACCG

AAAGCCATAGAAGTTGATCATGTTTTCCATTTAAAAATGATTTCTTGGAACAAGGTAATACTAATAGACACTCAGAGGCACCACATGGGCTGCTTTACAT

GGTCTTACGTAGAACCAAGAAATGTAACTTACCATGGTATGGGGGTCAGCATTGGGTGGGGTTCAGGTGTGCATTGGGAAAGCTGCAACGTCAGAACCCC

CTTGCTGCGACTGAAACTTCCAGGTCAGGTTGATCACACAGATGTTTTCTAAACCTTTGTTGTATTACTGCAATAAATCCTTTAACAGT
Translation
MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRER - UNI36020 - RFIDKKERLSQL

KNKQEEFQKE - UNI36020 - EVLKAMEGKRLTDQL - UNI6580 - RWKIMSCKMRIEQLKQTICKGNEEMKKN NSEGLLKNKEKNQKLYSRA

QRHQEKKEKIQRHNRKLGDLVEKKTIDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGR RDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCD

DHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPD - UNI2742 - DMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNS SEFCGE

NLSKQKLTRAVRKLNANILYLCSSQ HVNLDQLQPLHTLRNLMHLVSPRSEHLGR RSGPFEVRADLEESMEFVDPGVAGESDASGDERVSDEETDLGTD

WENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAASVTSWFKAYTGHR

For any suggestions or comments, please send an email to unitrap@crg.es