Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037533 (Rapgef6)
Chromosomal location
Chr 11: 54336349 - 54512785 (+)
Description
Rap guanine nucleotide exchange factor (GEF) 6 Gene [Source:MGI (curated);Acc:Rapgef6-003]
RefSeq_dna
NM_175258 
RefSeq_peptide
NP_780467.2 
UniGene
Mm.254404 Mm.406949 Mm.410091 
MGI
MGI:2384761 
Uniprot/SPTREMBL
Q5NCJ3 Q562E3 Q5NCJ4 Q5NCJ5 Q5NCJ2 Q8BX14 B2RUJ6 Q3TKC6 Q3TPI6 Q3UPQ2 Q5NCJ0 Q8BLC8 Q8R3E5 Q8VCK0 Q5DTR1 Q5NCJ1 
Human Ortholog
ENSG00000158987 (RAPGEF6)
Omim not available
UniTrap UNI1776
Vector Insertion
Chr 11: 54336621 - 54357080
Public Clones CF0294 (sanger) IST13639D3 (tigm) IST11241F4 (tigm) IST13603B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20376
Vector Insertion
Chr 11: 54357152 - 54359874
Public Clones not available
Private Clones OST365208 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26947
Vector Insertion
Chr 11: 54366291 - 54366376
Public Clones not available
Private Clones OST83406 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7121
Vector Insertion
Chr 11: 54381854 - 54381999
Public Clones RRJ463 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1705
Vector Insertion
Chr 11: 54424289 - 54424422
Public Clones AY0426 (sanger) CF0672 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8263
Vector Insertion
Chr 11: 54444859 - 54448261
Public Clones RRF111 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27755
Vector Insertion
Chr 11: 54456454 - 54462683
Public Clones not available
Private Clones OST50397 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9694
Vector Insertion
Chr 11: 54489918 - 54492740
Public Clones XG550 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22315
Vector Insertion
Chr 11: 54509581 - 54510672
Public Clones not available
Private Clones OST300559 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041060
Sequence
CACAAATTCTAACATGCTAGATGTCCAGGGAGGTGCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATGCCAAGAAACTGTATGAAGATGCCCAA

ATGGCAAGGAAAGTGAAACAGTATCTTTCTAGTCTGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTCACTGCAGTGGGAACCTGCATATGGTA

CCT - UNI9694 - TGACAAAGAACTTAACTGAAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACCATTGAGGTCAGTTGGCCAAACAGCTA

AAGTCCACTTGCATCAGCCACACAGAGTGAGCCAGGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGGAAGAAAGGACAAGCCAAAGACCATGT

GCTGA GTACAAGTTTACCTCAGAAAGGTTTAGGACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGACACTATTTCTGTAGCGTCCTCTCTGCA

CTCTAGCCCTCCTGCATCTCCTCAGAACTCCCCACGCAAAG GTTATACACTCACACCATCAAGTAAATGTGACAACTTGTCTGACTCCAGCCACAGTGA

AATCTCCTCTCGGTCCAGCATTGTGAGCAATGGTTCTGTTGACTCCATGTCTGCAGCTGGGCAGGATGAACGCTGTTCCTCCCACAGTCTGGCAGTTCCT

GAGCCCACAGGGGCATTGGAAAAGACAGATCACCCTTCCGGGATCTCAGACCACAGTCAGCTTGCTCACGG GTGGATGCTGTCAAAGCCGTGTCTTATC

AAGGGTGTAGCTGTCTCATCTTCTCTGAGCAGCGAAGAGATGTCTCATGAGCATGTTGTGCTGGAAGCAGCTGACAGTGGGCGGGGCAGTTGGACTTCCT

GTTCCAGCAGCTCCCATGACAACTTCCAAAGCCTTCAAAATCAAAAAAGCTGGGACTTCCTGAATTCTTACAGACACATGCATTTAGATGACCCTATTGC

AGAAGTTGAGCCCACTGACTGTGAGCCCTGTGCCTGTCCTAAAGGCTGCTCAAGAACTTGTGGCCAGTGCAAAGGCAGCCTAGAGACGAACCAGCTGAGG

CAGAGTTGGGCCTCCTCCAGCTCACTCTCGGACACATGTGAACCAAACTACGGGACAGTTAAGCGGAGGGTGTTGGAAAGTGCACCAGCAGAGGCACCTG

ATGGCTTGGAGCCCAGGGATACCACTGACCCTGTTTATAAAACTGTCACTTCCAGTACAGACAAGGGCTTGATTG - UNI22315 - AAAACGAGCAG

GTGTCAGCAGTCTAGCCTTTGGACAGAGTGTTGGAGAGCACTGGAAGTCAGGACCATGGACAAGAGCTCGTGGTTCTGTAGGCCAAGGCCATCAGCTCGC

TGCTGCCACTCATGCTGAGGGTTCCACACTGGGCTCTGAGGATGAGCTCTTCTGAGTCGTGCTTCCTTTTGTTCTGTCCCTGCAGGTGCAGTTTCCTTAC

CTGGGTGTTGCACCTGATCTCAGCCTATACTTTGCACATCACTCCTGCCTTGGGACCACATTCAAGCTCAGAGTTCTCCCCCTGTATATCACTATGAGTT

TTTCTTTTCGAGAGTCATTTTAAAGATAGTGGTATTATTATTATTTCCAAGCCATAGCTTGGGCTAAAAGGACACATTCAGAATGTCTGCCAATACCAAG

GATAGTCTTGTGTATTTGAAAAGTAACTTATTATTGCAAGTATTGTGATTTTGTTTGCATTCAAAAGCTCTTGTTAGCTGTTATTTGTCTTAGTCTATAA

AGCTGTCTGTGTGTGGTCTGAGCAGCAGTTGTCATCCCAACACAGGTACGGAGATGTGACAGCATTGTAGCAGACACTCAGGTGGGAACAAGACACCCGT

GCAGGTGCAGTGCAGGTGGCCAGCTCATCATGATGTGGGCTACAGCAGCCACAGGGGTCTCAGCAGTCTTTCGGAAAGGAGAACAAAGCGCAAGTAGGAA

GAAAGAACTCTAATTTCCAAAGAAGGAAAGATTAACATTGAACTTGTTTCTGAAATGAACATCATGTTGCACCCAATTGTGAGGATACTACAAACCCACT

GGCAGTGGCTTCTCAAAGGCTTTCTTTCTATAGAAACCCTAAGCTACCATTTCACAACACAAGTATGGAATCCCTAGATTAAAAGAAATATTGTAGGAGC

TGGAGAGATGGCGAAGATACTCTTGCAGAGGGCTGGATTTAATTTCAGCCCTCACATGGTGGCTTACAACTGCCTGCAACTCCACATCCAGGGGATCCGA

CACCCTCGTCTGACCTCCACAGGCACTTCATGCATGTGGCCCATAGGCATACATGCAGTCAGAATACCCCTACACACAC
Translation
 - UNI9694 -    MSHEHVVLEAADSGRGSWTSCSSSSHDNFQSLQNQKSWDFLNSYRHMHLDDPIAEVEPTDCEPCACPKGCSRTCGQCKGSLETN

QLRQSWASSSSLSDTCEPNYGTVKRRVLESAPAEAPDGLEPRDTTDPVYKTVTSSTDKGLIE - UNI22315 - ENEQVSAV
Transcript ENSMUST00000094536
Sequence
ATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGTTTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGATGGGCAAGAG CTTGACTCATGG

TATGTCATTTTAAATGGCACTGTAGAAATTAGTCATCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTTGGGATTGTCCCCACGCTGGATA

AGCAGCACATGCATGGAGCTGTCAGGACCAAAGTCGATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGGAGAATTTTAAATCATGTGGAAA

AAAATACTCACAAAGTTGAGGAAGAGGGAGAGATTGTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCAGGAAAGGACACATTGTAATCAA

G GCAACACCTGAGCGTCTCATCATGCATTTGATAGAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCCTCTTAACTTACAGGACATTTCT

TGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGGAATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 - GTGACACGGATTGTACTCTT

ATGGGTAAATAATCATTTTAATGATTTTGAAGGTGATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTTGGAAGATACA AAAATGAATGG

TCACCTCAGGTTATTGAATATTGCCTGTGCTGCAAAGGCTAAGTGGAGGCAAGTTGTACTGCAGAAGGCGTCCCGTGAGTCCCCGCTGCACTTCTGCCTT

ACTGGGGGCAGTGAGAAGGGATTTGGAGTCTTTGTTGAAGAAGTAGAATCTGGTAGCAAAGCTGCTGACGCAGGACTGAAAAGGGGTGATCAG GTAATG

GAAGTCAATGGACAAAACTTTGAGAATATTACACTTGCTAAAGCCCTTGAAATTTTGAGAAATAATACTCATCTTGCACTTACTGTGAAGACCAACATTT

TTG TGTTCAAAGAATTGCTCAGTAGGACTGAACAAGAGAAATCTGGTGTTCCTCATATTCCCAAAATTGCTGAAAAAAAAAGTAATCGCCATTCAATTC

AAGATGTCCCAGGGGATATGGAGCAGGCACCACAGGAGAAAGGAAATAAGAAAATTAAAGCAAATACCGTTTCAGGTGGAAGAAACAAAATCAGGAAAAT

TTTGGATAAAACACGATTTAGTATCTTGCCTCCAAAACTATTTAG - UNI27755 - TGACGGAGGCCTGAGTCAATCACAAGATGACAGCATTGTGG

GAACCAGGCACTGTAGGCACAGCCTGGCTATAATGCCAATTCCCGGAACACTTTCATCCAGCAGCCCAGATCTCTTACAGCCTACCACTAGCATGTTGGA

CTTTTCCAATCCTTCAG ATATTCCTGATCAAGTTATAAGAGTTTTCAAAGCAGATCAACAAAGTTGCTACATTATCATCAGTAAGGATACCACAGCTAA

AGAAGTGGTCTGCCAAGCTGTACAGGAATTCGGTTTGACTGGTGCATCTGACACATACTCCCTCTGTGAAGTGTCTGTTACTCCTGAGGGTGTTATAAAG

CAGAGAAGACTTCCGGACCAGTTCTCCAAATTAGCTGATAGAATTCAACTCAATGGAAG GTATTACCTAAAAAACAACATGGAAACAGAAACATTGTGT

TCTGATGAAGATGCTCAGGAACTACTTAAGGAAAGCCAGCTCTCCATGCTGCAGCTCAGTACCATCGAGGTCGCCACCCAGCTCTCCATGAGAGACTTTG

ATTTATTTCGTAACATTGAGCCTACTGAATACATTGATGATCTTTTTAAATTAGATTCCAAAACAGGAAATACTCACTTGAAACAATTTGAGGATATTGT

AAACCAAGAGACATTCTGGGTTGCCTCAGAGATTTTAAGTGAGTCAAATCAGCTGAAAAGAATGAAGATTATTAAACATTTTATCAAAATTGCTCTTCAT

TGCCGAGAATGCAAGAATTTCAATTCCATGTTTGCAATAATAAG TGGCTTGAACCTGGCACCGGTAGCACGACTCAGAGGCACTTGGGAAAAGTTGCCA

AGCAAATATGAGAAACATCTTCAAGATCTACAAGACCTTTTTGATCCATCTAGAAATATGGCAAAATACAGAAATATTCTTAGTAGTCAAAGCATGCAGC

CTCCAATTATTCCACTCTTCCCTGTTGTCAAGAAAGATATGACATTTCTCCATGAAG GAAATGACTCCAAAGTAGATGGCTTAGTAAACTTCGAGAAGC

TAAGAATGATTGCCAAGGAAATCCGTCATATTATTCGAATGACTTCTGCCAACATGGACCCTGCCATGATGTTCCGACAGAG GTCATTGAGTCAAGGCA

GCACAAATTCTAACATGCTAGATGTCCAGGGAGGTGCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATGCCAAGAAACTGTATGAAGATGCCCA

AATGGCAAGGAAAGTGAAACAGTATCTTTCTAGTCTGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTCACTGCAGTGGGAACCTGCATATGGT

ACCT - UNI9694 - TGACAAAGAACTTAACTGAAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACCATTGAGGTCAGTTGGCCAAACAGCT

AAAGTCCACTTGCATCAGCCACACAGAGTGAGCCAGGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGGAAGAAAGGACAAGCCAAAGACCATG

TGCTGA GTACAAGTTTACCTCAGAAAGGTTTAGGACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGACACTATTTCTGTAGCGTCCTCTCTGC

ACTCTAGCCCTCCTGCATCTCCTCAGAACTCCCCACGCAAAG TTGGCAGTATCCTATCTGATCACAGCATCCTGTTGCGTCTCTCAGGGTCTTCCTCAT

CCCCTCCCCGTGAGCCCAGCACCAAGATCAGTGGCCAGAGCTGCCCCGGAATAGGTGGGGTTTACTTGCAAAAGAAAATCCTTCAGATTACTGGGAGCAC

AGCCAAAAGAACAGACAGGACCAAGAAGGCCACTGAGGAGAATAGAGACAGGACAAGGTGTGAGGACACTACCAGGAGAAGGATGACATCCCCGTTTAGA

AGATTTAGGGAGAGAACGCTTTCAAGGGAGAGACTAGTCAACAACCAAAAAGAGGATGCACATCACAATCAAGCTACAGACAGCTGTGAGAAAGTGAAGG

ATGTTGGAAGCAACATCACAGATGAGAGAGGGAATGCCATCTACGACTCGAGTAGCCAAGGCCACAGTACCGCGCTCAGCTGCTTCTGTACGCGGTTCAA

GACTAAAAGGAGAAAGACTCTCTGA
Translation
MSVRRELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDYWRILNHV

EKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK - UNI826

3 - VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDT KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEVESGSKAA

DAGLKRGDQ VMEVNGQNFENITLAKALEILRNNTHLALTVKTNIFV VFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQEKGNKKIK

ANTVSGGRNKIRKILDKTRFSILPPKLFS - UNI27755 - SDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSD DI

PDQVIRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR RYYLKNNMETETLCSDEDAQ

ELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKN

FNSMFAIIS SGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEG GNDSKVDGLVNFEKLRM

IAKEIRHIIRMTSANMDPAMMFRQR RSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMMSLQWEPAYGT

L - UNI9694 - LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKDHVLS STSLPQKGLGPTEEVSVKKHT

EDTISVASSLHSSPPASPQNSPRKV VGSILSDHSILLRLSGSSSSPPREPSTKISGQSCPGIGGVYLQKKILQITGSTAKRTDRTKKATEENRDRTRCE

DTTRRRMTSPFRRFRERTLSRERLVNNQKEDAHHNQATDSCEKVKDVGSNITDERGNAIYDSSSQGHSTALSCFCTRFKTKRRKTL
Transcript ENSMUST00000108894
Sequence
ATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGTTTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGATGGGCAAGAG CTTGACTCATGG

TATGTCATTTTAAATGGCACTGTAGAAATTAGTCATCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTTGGGATTGTCCCCACGCTGGATA

AGCAGCACATGCATGGAGCTGTCAGGACCAAAGTCGATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGGAGAATTTTAAATCATGTGGAAA

AAAATACTCACAAAGTTGAGGAAGAGGGAGAGATTGTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCAGGAAAGGACACATTGTAATCAA

G GCAACACCTGAGCGTCTCATCATGCATTTGATAGAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCCTCTTAACTTACAGGACATTTCT

TGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGGAATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 - GTGACACGGATTGTACTCTT

ATGGGTAAATAATCATTTTAATGATTTTGAAGGTGATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTTGGAAGATACA AAAATGAATGG

TCACCTCAGGTTATTGAATATTGCCTGTGCTGCAAAGGCTAAGTGGAGGCAAGTTGTACTGCAGAAGGCGTCCCGTGAGTCCCCGCTGCACTTCTGCCTT

ACTGGGGGCAGTGAGAAGGGATTTGGAGTCTTTGTTGAAGAAGTAGAATCTGGTAGCAAAGCTGCTGACGCAGGACTGAAAAGGGGTGATCAG GTAATG

GAAGTCAATGGACAAAACTTTGAGAATATTACACTTGCTAAAGCCCTTGAAATTTTGAGAAATAATACTCATCTTGCACTTACTGTGAAGACCAACATTT

TTG TGTTCAAAGAATTGCTCAGTAGGACTGAACAAGAGAAATCTGGTGTTCCTCATATTCCCAAAATTGCTGAAAAAAAAAGTAATCGCCATTCAATTC

AAGATGTCCCAGGGGATATGGAGCAGGCACCACAGGAGAAAGGAAATAAGAAAATTAAAGCAAATACCGTTTCAGGTGGAAGAAACAAAATCAGGAAAAT

TTTGGATAAAACACGATTTAGTATCTTGCCTCCAAAACTATTTAG - UNI27755 - TGACGGAGGCCTGAGTCAATCACAAGATGACAGCATTGTGG

GAACCAGGCACTGTAGGCACAGCCTGGCTATAATGCCAATTCCCGGAACACTTTCATCCAGCAGCCCAGATCTCTTACAGCCTACCACTAGCATGTTGGA

CTTTTCCAATCCTTCAG ATATTCCTGATCAAGTTATAAGAGTTTTCAAAGCAGATCAACAAAGTTGCTACATTATCATCAGTAAGGATACCACAGCTAA

AGAAGTGGTCTGCCAAGCTGTACAGGAATTCGGTTTGACTGGTGCATCTGACACATACTCCCTCTGTGAAGTGTCTGTTACTCCTGAGGGTGTTATAAAG

CAGAGAAGACTTCCGGACCAGTTCTCCAAATTAGCTGATAGAATTCAACTCAATGGAAG GTATTACCTAAAAAACAACATGGAAACAGAAACATTGTGT

TCTGATGAAGATGCTCAGGAACTACTTAAGGAAAGCCAGCTCTCCATGCTGCAGCTCAGTACCATCGAGGTCGCCACCCAGCTCTCCATGAGAGACTTTG

ATTTATTTCGTAACATTGAGCCTACTGAATACATTGATGATCTTTTTAAATTAGATTCCAAAACAGGAAATACTCACTTGAAACAATTTGAGGATATTGT

AAACCAAGAGACATTCTGGGTTGCCTCAGAGATTTTAAGTGAGTCAAATCAGCTGAAAAGAATGAAGATTATTAAACATTTTATCAAAATTGCTCTTCAT

TGCCGAGAATGCAAGAATTTCAATTCCATGTTTGCAATAATAAG TGGCTTGAACCTGGCACCGGTAGCACGACTCAGAGGCACTTGGGAAAAGTTGCCA

AGCAAATATGAGAAACATCTTCAAGATCTACAAGACCTTTTTGATCCATCTAGAAATATGGCAAAATACAGAAATATTCTTAGTAGTCAAAGCATGCAGC

CTCCAATTATTCCACTCTTCCCTGTTGTCAAGAAAGATATGACATTTCTCCATGAAG GAAATGACTCCAAAGTAGATGGCTTAGTAAACTTCGAGAAGC

TAAGAATGATTGCCAAGGAAATCCGTCATATTATTCGAATGACTTCTGCCAACATGGACCCTGCCATGATGTTCCGACAGAG GAAGAAGAGGTGGCGGA

GTCTGGG GTCATTGAGTCAAGGCAGCACAAATTCTAACATGCTAGATGTCCAGGGAGGTGCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATG

CCAAGAAACTGTATGAAGATGCCCAAATGGCAAGGAAAGTGAAACAGTATCTTTCTAGTCTGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTC

ACTGCAGTGGGAACCTGCATATGGTACCT - UNI9694 - TGACAAAGAACTTAACTGAAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACC

ATTGAGGTCAGTTGGCCAAACAGCTAAAGTCCACTTGCATCAGCCACACAGAGTGAGCCAGGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGG

AAGAAAGGACAAGCCAAAGACCATGTGCTGA GTACAAGTTTACCTCAGAAAGGTTTAGGACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGAC

ACTATTTCTGTAGCGTCCTCTCTGCACTCTAGCCCTCCTGCATCTCCTCAGAACTCCCCACGCAAAG TTGGCAGTATCCTATCTGATCACAGCATCCTG

TTGCGTCTCTCAGGGTCTTCCTCATCCCCTCCCCGTGAGCCCAGCACCAAGATCAGTGGCCAGAGCTGCCCCGGAATAGGTGGGGTTTACTTGCAAAAGA

AAATCCTTCAGATTACTGGGAGCACAGCCAAAAGAACAGACAGGACCAAGAAGGCCACTGAGGAGAATAGAGACAGGACAAGGTGTGAGGACACTACCAG

GAGAAGGATGACATCCCCGTTTAGAAGATTTAGGGAGAGAACGCTTTCAAGGGAGAGACTAGTCAACAACCAAAAAGAGGATGCACATCACAATCAAGCT

ACAGACAGCTGTGAGAAAGTGAAGGATGTTGGAAGCAACATCACAGATGAGAGAGGGAATGCCATCTACGACTCGAGTAGCCAAGGCCACAGTACCGCGC

TCAGCTGCTTCTGTACGCGGTTCAAGACTAAAAGGAGAAAGACTCTCTGAAAAGTTTCTTATCTAACATTAGTGTTAAACTTGTTTTAAGTTATTCATGT

AAATGTAGCTCGAACTCAGCCATCTGTCA
Translation
MSVRRELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDYWRILNHV

EKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK - UNI826

3 - VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDT KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEVESGSKAA

DAGLKRGDQ VMEVNGQNFENITLAKALEILRNNTHLALTVKTNIFV VFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQEKGNKKIK

ANTVSGGRNKIRKILDKTRFSILPPKLFS - UNI27755 - SDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSD DI

PDQVIRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR RYYLKNNMETETLCSDEDAQ

ELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKN

FNSMFAIIS SGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEG GNDSKVDGLVNFEKLRM

IAKEIRHIIRMTSANMDPAMMFRQR RKKRWRSLG GSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMM

SLQWEPAYGTL - UNI9694 - LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKDHVLS STSLPQKGLGP

TEEVSVKKHTEDTISVASSLHSSPPASPQNSPRKV VGSILSDHSILLRLSGSSSSPPREPSTKISGQSCPGIGGVYLQKKILQITGSTAKRTDRTKKAT

EENRDRTRCEDTTRRRMTSPFRRFRERTLSRERLVNNQKEDAHHNQATDSCEKVKDVGSNITDERGNAIYDSSSQGHSTALSCFCTRFKTKRRKTL
Transcript ENSMUST00000050145
Sequence
GTTCTCGGCCAGTCTCGCCCCCGCGCAGGCGTCTTTCTGGCCAGTCGCGCGTGGGCTGAGGCCCTGGGCGGGCGTTGCGAAGACTTGTTTGCTTGAGTTT

GGACCCTGCGACAGTTCTCATTTCCCTCCCGGTGGGGCTGGCGTACACCCGGAGCTGGAGAATGGGCAGCTAGACGCAGGCTAGGGAGCCTGTGGCTGCG

GACATGAACTCGCCCGTGGACCCCGGCGCTCGGCAGGCACTGAGGAAGAAGCCGCCCGAGCGGACTCCTGAG - UNI1776 - GACTTAAATATTATT

TATTCTTATCTGCATGGGATGGAAATACTATCAAACCTCAGGGAGCATCAGCTTAG - UNI20376 - GTTAATGTCTACAAGAGCACGCTATGAGAG

ATACAGTGGCAATCAAATGCTTTTTTG - UNI26947 - TTCAGAAACTATTGCCAGATGTTGGTATATCCTGCTTTCTGGATCTGTACTTGTAAAAG

ATTCTATGGTCCTTCCTCCTTGCAG - UNI26947 - TTTTGGTAAGCAGTTTGGAGGAAAAAGAGGATGTGATTGTCTTGTGTTAGAACCTTCAGAA

ATGATTGTG - UNI7121 - GTAGAGAATTCCAAAGATAATGAAGACAGTATTTTACAAAGAGAAATTCCTGCCAGACAGTCTCGACGAAGGTTTCGG

AAAATTAACTATAAAGGAGAACGCCAAACCATAATAGATGGAGTGGATATTAATAACTACCTTTCG - UNI1705 - - UNI7121 - CTTCCAGCT

GATCTTACCAAGATGCACCTCACAGACAACCCTCATCCACAGGTGACGCATGTGTCTTCTAGTCAGTCTGGCTGTAGCATTGCCAGTGACTCTGGGAGCA

GCAGTTTATCCGATATCTATCAG - UNI1705 - GCTACAGAGAGTGAAGTAGGAGATGTAGATTTAACACGCCTTCCAGAAGGACCTGTTGATTCTG

AGGATGAAGAGGAGGAGGAAGAAGAGATTGATAGAACAGATCCACTGCAGGGTCGAGATCTTGTTCGGGAGTGTCTTGAAAAGGAACCCGCAGACAAAAC

TGATGATGATGTTG AACAGTTACTTGAGTTCATGCACCAGCTGCCTGCCTTTGCGAACATGACCATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGT

TTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGATGGGCAAGAG CTTGACTCATGGTATGTCATTTTAAATGGCACTGTAGAAATTAGTCA

TCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTTGGGATTGTCCCCACGCTGGATAAGCAGCACATGCATGGAGCTGTCAGGACCAAAGTC

GATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGGAGAATTTTAAATCATGTGGAAAAAAATACTCACAAAGTTGAGGAAGAGGGAGAGATT

GTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCAGGAAAGGACACATTGTAATCAAG GCAACACCTGAGCGTCTCATCATGCATTTGATA

GAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCCTCTTAACTTACAGGACATTTCTTGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGG

AATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 - GTGACACGGATTGTACTCTTATGGGTAAATAATCATTTTAATGATTTTGAAGGTG

ATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTTGGAAGATACA AAAATGAATGGTCACCTCAGGTTATTGAATATTGCCTGTGCTGCAA

AGGCTAAGTGGAGGCAAGTTGTACTGCAGAAGGCGTCCCGTGAGTCCCCGCTGCACTTCTGCCTTACTGGGGGCAGTGAGAAGGGATTTGGAGTCTTTGT

TGAAGAAGTAGAATCTGGTAGCAAAGCTGCTGACGCAGGACTGAAAAGGGGTGATCAG GTAATGGAAGTCAATGGACAAAACTTTGAGAATATTACACT

TGCTAAAGCCCTTGAAATTTTGAGAAATAATACTCATCTTGCACTTACTGTGAAGACCAACATTTTTG TGTTCAAAGAATTGCTCAGTAGGACTGAACA

AGAGAAATCTGGTGTTCCTCATATTCCCAAAATTGCTGAAAAAAAAAGTAATCGCCATTCAATTCAAGATGTCCCAGGGGATATGGAGCAGGCACCACAG

GAGAAAGGAAATAAGAAAATTAAAGCAAATACCGTTTCAGGTGGAAGAAACAAAATCAGGAAAATTTTGGATAAAACACGATTTAGTATCTTGCCTCCAA

AACTATTTAG - UNI27755 - TGACGGAGGCCTGAGTCAATCACAAGATGACAGCATTGTGGGAACCAGGCACTGTAGGCACAGCCTGGCTATAATG

CCAATTCCCGGAACACTTTCATCCAGCAGCCCAGATCTCTTACAGCCTACCACTAGCATGTTGGACTTTTCCAATCCTTCAG ATATTCCTGATCAAGTT

ATAAGAGTTTTCAAAGCAGATCAACAAAGTTGCTACATTATCATCAGTAAGGATACCACAGCTAAAGAAGTGGTCTGCCAAGCTGTACAGGAATTCGGTT

TGACTGGTGCATCTGACACATACTCCCTCTGTGAAGTGTCTGTTACTCCTGAGGGTGTTATAAAGCAGAGAAGACTTCCGGACCAGTTCTCCAAATTAGC

TGATAGAATTCAACTCAATGGAAG GTATTACCTAAAAAACAACATGGAAACAGAAACATTGTGTTCTGATGAAGATGCTCAGGAACTACTTAAGGAAAG

CCAGCTCTCCATGCTGCAGCTCAGTACCATCGAGGTCGCCACCCAGCTCTCCATGAGAGACTTTGATTTATTTCGTAACATTGAGCCTACTGAATACATT

GATGATCTTTTTAAATTAGATTCCAAAACAGGAAATACTCACTTGAAACAATTTGAGGATATTGTAAACCAAGAGACATTCTGGGTTGCCTCAGAGATTT

TAAGTGAGTCAAATCAGCTGAAAAGAATGAAGATTATTAAACATTTTATCAAAATTGCTCTTCATTGCCGAGAATGCAAGAATTTCAATTCCATGTTTGC

AATAATAAG TGGCTTGAACCTGGCACCGGTAGCACGACTCAGAGGCACTTGGGAAAAGTTGCCAAGCAAATATGAGAAACATCTTCAAGATCTACAAGA

CCTTTTTGATCCATCTAGAAATATGGCAAAATACAGAAATATTCTTAGTAGTCAAAGCATGCAGCCTCCAATTATTCCACTCTTCCCTGTTGTCAAGAAA

GATATGACATTTCTCCATGAAG GAAATGACTCCAAAGTAGATGGCTTAGTAAACTTCGAGAAGCTAAGAATGATTGCCAAGGAAATCCGTCATATTATT

CGAATGACTTCTGCCAACATGGACCCTGCCATGATGTTCCGACAGAG GAAGAAGAGGTGGCGGAGTCTGGG GTCATTGAGTCAAGGCAGCACAAATTC

TAACATGCTAGATGTCCAGGGAGGTGCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATGCCAAGAAACTGTATGAAGATGCCCAAATGGCAAGG

AAAGTGAAACAGTATCTTTCTAGTCTGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTCACTGCAGTGGGAACCTGCATATGGTACCT - UNI

9694 - TGACAAAGAACTTAACTGAAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACCATTGAGGTCAGTTGGCCAAACAGCTAAAGTCCACT

TGCATCAGCCACACAGAGTGAGCCAGGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGGAAGAAAGGACAAGCCAAAGACCATGTGCTGA GTA

CAAGTTTACCTCAGAAAGGTTTAGGACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGACACTATTTCTGTAGCGTCCTCTCTGCACTCTAGCCC

TCCTGCATCTCCTCAGAACTCCCCACGCAAAG TTGGCAGTATCCTATCTGATCACAGCATCCTGTTGCGTCTCTCAGGGTCTTCCTCATCCCCTCCCCG

TGAGCCCAGCACCAAGATCAGTGGCCAGAGCTGCCCCGGAATAGGTGGGGTTTACTTGCAAAAGAAAATCCTTCAGATTACTGGGAGCACAGCCAAAAGA

ACAGACAGGACCAAGAAGGCCACTGAGGAGAATAGAGACAGGACAAGGTGTGAGGACACTACCAGGAGAAGGATGACATCCCCGTTTAGAAGATTTAGGG

AGAGAACGCTTTCAAGGGAGAGACTAGTCAACAACCAAAAAGAGGATGCACATCACAATCAAGCTACAGACAGCTGTGAGAAAGTGAAGGATGTTGGAAG

CAACATCACAGATGAGAGAGGGAATGCCATCTACGACTCGAGTAGCCAAGGCCACAGTACCGCGCTCAGCTGCTTCTGTACGCGGTTCAAGACTAAAAGG

AGAAAGACTCTCTGA
Translation
 - UNI1776 -  - UNI20376 -  - UNI26947 -  - UNI26947 -  - UNI7121 -  - UNI1705 - - UNI7121 -  - UNI1

705 -  MSVRRELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDY

WRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK -

 UNI8263 - VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDT KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEV

ESGSKAADAGLKRGDQ VMEVNGQNFENITLAKALEILRNNTHLALTVKTNIFV VFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQE

KGNKKIKANTVSGGRNKIRKILDKTRFSILPPKLFS - UNI27755 - SDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFS

NPSD DIPDQVIRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR RYYLKNNMETETL

CSDEDAQELLKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIAL

HCRECKNFNSMFAIIS SGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEG GNDSKVDGLV

NFEKLRMIAKEIRHIIRMTSANMDPAMMFRQR RKKRWRSLG GSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTD

EEKFQMMSLQWEPAYGTL - UNI9694 - LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKDHVLS STSL

PQKGLGPTEEVSVKKHTEDTISVASSLHSSPPASPQNSPRKV VGSILSDHSILLRLSGSSSSPPREPSTKISGQSCPGIGGVYLQKKILQITGSTAKRT

DRTKKATEENRDRTRCEDTTRRRMTSPFRRFRERTLSRERLVNNQKEDAHHNQATDSCEKVKDVGSNITDERGNAIYDSSSQGHSTALSCFCTRFKTKRR

KTL
Transcript ENSMUST00000108895
Sequence
GTCGCGCGTGGGCTGAGGCCCTGGGCGGGCGTTGCGAAGACTTGTTTGCTTGAGTTTGGACCCTGCGACAGTTCTCATTTCCCTCCCGGTGGGGCTGGCG

TACACCCGGAGCTGGAGAATGGGCAGCTAGACGCAGGCTAGGGAGCCTGTGGCTGCGGACATGAACTCGCCCGTGGACCCCGGCGCTCGGCAGGCACTGA

GGAAGAAGCCGCCCGAGCGGACTCCTGAG - UNI1776 - GACTTAAATATTATTTATTCTTATCTGCATGGGATGGAAATACTATCAAACCTCAGGG

AGCATCAGCTTAG - UNI20376 - GTTAATGTCTACAAGAGCACGCTATGAGAGATACAGTGGCAATCAAATGCTTTTTTG - UNI26947 - TT

CAGAAACTATTGCCAGATGTTGGTATATCCTGCTTTCTGGATCTGTACTTGTAAAAGATTCTATGGTCCTTCCTCCTTGCAG - UNI26947 - TTTT

GGTAAGCAGTTTGGAGGAAAAAGAGGATGTGATTGTCTTGTGTTAGAACCTTCAGAAATGATTGTG - UNI7121 - GTAGAGAATTCCAAAGATAAT

GAAGACAGTATTTTACAAAGAGAAATTCCTGCCAGACAGTCTCGACGAAGGTTTCGGAAAATTAACTATAAAGGAGAACGCCAAACCATAATAGATGGAG

TGGATATTAATAACTACCTTTCG - UNI1705 - - UNI7121 - CTTCCAGCTGATCTTACCAAGATGCACCTCACAGACAACCCTCATCCACAGG

TGACGCATGTGTCTTCTAGTCAGTCTGGCTGTAGCATTGCCAGTGACTCTGGGAGCAGCAGTTTATCCGATATCTATCAG - UNI1705 - GCTACAG

AGAGTGAAGTAGGAGATGTAGATTTAACACGCCTTCCAGAAGGACCTGTTGATTCTGAGGATGAAGAGGAGGAGGAAGAAGAGATTGATAGAACAGATCC

ACTGCAGGGTCGAGATCTTGTTCGGGAGTGTCTTGAAAAGGAACCCGCAGACAAAACTGATGATGATGTTG AACAGTTACTTGAGTTCATGCACCAGCT

GCCTGCCTTTGCGAACATGACCATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGTTTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGAT

GGGCAAGAG CTTGACTCATGGTATGTCATTTTAAATGGCACTGTAGAAATTAGTCATCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTT

GGGATTGTCCCCACGCTGGATAAGCAGCACATGCATGGAGCTGTCAGGACCAAAGTCGATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGG

AGAATTTTAAATCATGTGGAAAAAAATACTCACAAAGTTGAGGAAGAGGGAGAGATTGTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCA

GGAAAGGACACATTGTAATCAAG GCAACACCTGAGCGTCTCATCATGCATTTGATAGAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCC

TCTTAACTTACAGGACATTTCTTGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGGAATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 

- GTGACACGGATTGTACTCTTATGGGTAAATAATCATTTTAATGATTTTGAAGGTGATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTT

GGAAGATACAGTAAGGCTCAAAAGAATTTGTTTTTATAATTCAGCATTCTCCCTACCCCTCAGCAAGAACAGCAACTCAGAACACGTTCTGTCTTCTCCC

GTGTCTGTTGTAGCATGAGAATGTCTCACCAAAATAAAATTTAAAAAATGTT
Translation
MNSPVDPGARQALRKKPPERTPE - UNI1776 - DLNIIYSYLHGMEILSNLREHQLR - UNI20376 - RLMSTRARYERYSGNQMLFC - UNI

26947 - CSETIARCWYILLSGSVLVKDSMVLPPCS - UNI26947 - SFGKQFGGKRGCDCLVLEPSEMIV - UNI7121 - VENSKDNEDSIL

QREIPARQSRRRFRKINYKGERQTIIDGVDINNYLS - UNI1705 - - UNI7121 - LPADLTKMHLTDNPHPQVTHVSSSQSGCSIASDSGSSSL

SDIYQ - UNI1705 - ATESEVGDVDLTRLPEGPVDSEDEEEEEEEIDRTDPLQGRDLVRECLEKEPADKTDDDVE EQLLEFMHQLPAFANMTMSVR

RELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDYWRILNHVEKNT

HKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK - UNI8263 - 

VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDTVRLKRICFYNSAFSLPLSKNSNSEHVLSSPVSVVA
Transcript ENSMUST00000102743
Sequence
GTTCTCGGCCAGTCTCGCCCCCGCGCAGGCGTCTTTCTGGCCAGTCGCGCGTGGGCTGAGGCCCTGGGCGGGCGTTGCGAAGACTTGTTTGCTTGAGTTT

GGACCCTGCGACAGTTCTCATTTCCCTCCCGGTGGGGCTGGCGTACACCCGGAGCTGGAGAATGGGCAGCTAGACGCAGGCTAGGGAGCCTGTGGCTGCG

GACATGAACTCGCCCGTGGACCCCGGCGCTCGGCAGGCACTGAGGAAGAAGCCGCCCGAGCGGACTCCTGAG - UNI1776 - GACTTAAATATTATT

TATTCTTATCTGCATGGGATGGAAATACTATCAAACCTCAGGGAGCATCAGCTTAG - UNI20376 - GTTAATGTCTACAAGAGCACGCTATGAGAG

ATACAGTGGCAATCAAATGCTTTTTTG - UNI26947 - TTCAGAAACTATTGCCAGATGTTGGTATATCCTGCTTTCTGGATCTGTACTTGTAAAAG

ATTCTATGGTCCTTCCTCCTTGCAG - UNI26947 - TTTTGGTAAGCAGTTTGGAGGAAAAAGAGGATGTGATTGTCTTGTGTTAGAACCTTCAGAA

ATGATTGTG - UNI7121 - GTAGAGAATTCCAAAGATAATGAAGACAGTATTTTACAAAGAGAAATTCCTGCCAGACAGTCTCGACGAAGGTTTCGG

AAAATTAACTATAAAGGAGAACGCCAAACCATAATAGATGGAGTGGATATTAATAACTACCTTTCG - UNI1705 - - UNI7121 - CTTCCAGCT

GATCTTACCAAGATGCACCTCACAGACAACCCTCATCCACAGGTGACGCATGTGTCTTCTAGTCAGTCTGGCTGTAGCATTGCCAGTGACTCTGGGAGCA

GCAGTTTATCCGATATCTATCAG - UNI1705 - GCTACAGAGAGTGAAGTAGGAGATGTAGATTTAACACGCCTTCCAGAAGGACCTGTTGATTCTG

AGGATGAAGAGGAGGAGGAAGAAGAGATTGATAGAACAGATCCACTGCAGGGTCGAGATCTTGTTCGGGAGTGTCTTGAAAAGGAACCCGCAGACAAAAC

TGATGATGATGTTG AACAGTTACTTGAGTTCATGCACCAGCTGCCTGCCTTTGCGAACATGACCATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGT

TTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGATGGGCAAGAG CTTGACTCATGGTATGTCATTTTAAATGGCACTGTAGAAATTAGTCA

TCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTTGGGATTGTCCCCACGCTGGATAAGCAGCACATGCATGGAGCTGTCAGGACCAAAGTC

GATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGGAGAATTTTAAATCATGTGGAAAAAAATACTCACAAAGTTGAGGAAGAGGGAGAGATT

GTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCAGGAAAGGACACATTGTAATCAAG GCAACACCTGAGCGTCTCATCATGCATTTGATA

GAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCCTCTTAACTTACAGGACATTTCTTGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGG

AATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 - GTGACACGGATTGTACTCTTATGGGTAAATAATCATTTTAATGATTTTGAAGGTG

ATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTTGGAAGATACA AAAATGAATGGTCACCTCAGGTTATTGAATATTGCCTGTGCTGCAA

AGGCTAAGTGGAGGCAAGTTGTACTGCAGAAGGCGTCCCGTGAGTCCCCGCTGCACTTCTGCCTTACTGGGGGCAGTGAGAAGGGATTTGGAGTCTTTGT

TGAAGAAGTAGAATCTGGTAGCAAAGCTGCTGACGCAGGACTGAAAAGGGGTGATCAG GTAATGGAAGTCAATGGACAAAACTTTGAGAATATTACACT

TGCTAAAGCCCTTGAAATTTTGAGAAATAATACTCATCTTGCACTTACTGTGAAGACCAACATTTTTG TGTTCAAAGAATTGCTCAGTAGGACTGAACA

AGAGAAATCTGGTGTTCCTCATATTCCCAAAATTGCTGAAAAAAAAAGTAATCGCCATTCAATTCAAGATGTCCCAGGGGATATGGAGCAGGCACCACAG

GAGAAAGGAAATAAGAAAATTAAAGCAAATACCGTTTCAGGTGGAAGAAACAAAATCAGGAAAATTTTGGATAAAACACGATTTAGTATCTTGCCTCCAA

AACTATTTAG - UNI27755 - TGACGGAGGCCTGAGTCAATCACAAGATGACAGCATTGTGGGAACCAGGCACTGTAGGCACAGCCTGGCTATAATG

CCAATTCCCGGAACACTTTCATCCAGCAGCCCAGATCTCTTACAGCCTACCACTAGCATGTTGGACTTTTCCAATCCTTCAG ATATTCCTGATCAAGTT

ATAAGAGTTTTCAAAGCAGATCAACAAAGTTGCTACATTATCATCAGTAAGGATACCACAGCTAAAGAAGTGGTCTGCCAAGCTGTACAGGAATTCGGTT

TGACTGGTGCATCTGACACATACTCCCTCTGTGAAGTGTCTGTTACTCCTGAGGGTGTTATAAAGCAGAGAAGACTTCCGGACCAGTTCTCCAAATTAGC

TGATAGAATTCAACTCAATGGAAG GTATTACCTAAAAAACAACATGGAAACAGAAACATTGTGTTCTGATGAAGATGCTCAGGAACTACTTAAGGAAAG

CCAGCTCTCCATGCTGCAGCTCAGTACCATCGAGGTCGCCACCCAGCTCTCCATGAGAGACTTTGATTTATTTCGTAACATTGAGCCTACTGAATACATT

GATGATCTTTTTAAATTAGATTCCAAAACAGGAAATACTCACTTGAAACAATTTGAGGATATTGTAAACCAAGAGACATTCTGGGTTGCCTCAGAGATTT

TAAGTGAGTCAAATCAGCTGAAAAGAATGAAGATTATTAAACATTTTATCAAAATTGCTCTTCATTGCCGAGAATGCAAGAATTTCAATTCCATGTTTGC

AATAATAAG TGGCTTGAACCTGGCACCGGTAGCACGACTCAGAGGCACTTGGGAAAAGTTGCCAAGCAAATATGAGAAACATCTTCAAGATCTACAAGA

CCTTTTTGATCCATCTAGAAATATGGCAAAATACAGAAATATTCTTAGTAGTCAAAGCATGCAGCCTCCAATTATTCCACTCTTCCCTGTTGTCAAGAAA

GATATGACATTTCTCCATGAAG GAAATGACTCCAAAGTAGATGGCTTAGTAAACTTCGAGAAGCTAAGAATGATTGCCAAGGAAATCCGTCATATTATT

CGAATGACTTCTGCCAACATGGACCCTGCCATGATGTTCCGACAGAG GTCATTGAGTCAAGGCAGCACAAATTCTAACATGCTAGATGTCCAGGGAGGT

GCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATGCCAAGAAACTGTATGAAGATGCCCAAATGGCAAGGAAAGTGAAACAGTATCTTTCTAGTC

TGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTCACTGCAGTGGGAACCTGCATATGGTACCT - UNI9694 - TGACAAAGAACTTAACTG

AAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACCATTGAGGTCAGTTGGCCAAACAGCTAAAGTCCACTTGCATCAGCCACACAGAGTGAGCCA

GGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGGAAGAAAGGACAAGCCAAAGACCATGTGCTGA GTACAAGTTTACCTCAGAAAGGTTTAGG

ACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGACACTATTTCTGTAGCGTCCTCTCTGCACTCTAGCCCTCCTGCATCTCCTCAGAACTCCCCA

CGCAAAG GTTATACACTCACACCATCAAGTAAATGTGACAACTTGTCTGACTCCAGCCACAGTGAAATCTCCTCTCGGTCCAGCATTGTGAGCAATGGT

TCTGTTGACTCCATGTCTGCAGCTGGGCAGGATGAACGCTGTTCCTCCCACAGTCTGGCAGTTCCTGAGCCCACAGGGGCATTGGAAAAGACAGATCACC

CTTCCGGGATCTCAGACCACAGTCAGCTTGCTCACGG GTGGATGCTGTCAAAGCCGTGTCTTATCAAGGGTGTAGCTGTCTCATCTTCTCTGAGCAGCG

AAGAGATGTCTCATGAGCATGTTGTGCTGGAAGCAGCTGACAGTGGGCGGGGCAGTTGGACTTCCTGTTCCAGCAGCTCCCATGACAACTTCCAAAGCCT

TCAAAATCAAAAAAGCTGGGACTTCCTGAATTCTTACAGACACATGCATTTAGATGACCCTATTGCAGAAGTTGAGCCCACTGACTGTGAGCCCTGTGCC

TGTCCTAAAGGCTGCTCAAGAACTTGTGGCCAGTGCAAAGGCAGCCTAGAGACGAACCAGCTGAGGCAGAGTTGGGCCTCCTCCAGCTCACTCTCGGACA

CATGTGAACCAAACTACGGGACAGTTAAGCGGAGGGTGTTGGAAAGTGCACCAGCAGAGGCACCTGATGGCTTGGAGCCCAGGGATACCACTGACCCTGT

TTATAAAACTGTCACTTCCAGTACAGACAAGGGCTTGATTG TGTACTGTGTCACCTCACCCAAGAAAGGTGATAGGTATAGGGAGCCACCGCCCACTCC

TCCAGGATATCTGGGAATTTCTTTAGCGGACCTAAAGGAAGGACCCCACCCGCACCTAAAACCTCCAGACTATAGTGTGGCAGTACAGAGATCAAAGATG

ATGCTTAACAGCCTGTCTAGACTGCCGCCAGCTCCTCCCAGTAGCCACACCTCGGCCTGGGTTCCCTCGAAGATTGGATCCCAGCCTCAAAGGCATAGCC

ATCCCAAGCTAGCAGATGTGGCTGATGCAGATAGCGAAGCAGATG - UNI22315 - AAAACGAGCAGGTGTCAGCAGTCTAGCCTTTGGACAGAGTG

TTGGAGAGCACTGGAAGTCAGGACCATGGACAAGAGCTCGTGGTTCTGTAGGCCAAGGCCATCAGCTCGCTGCTGCCACTCATGCTGAGGGTTCCACACT

GGGCTCTGAGGATGAGCTCTTCTGAGTCGTGCTTCCTTTTGTTCTGTCCCTGCAGGTGCAGTTTCCTTACCTGGGTGTTGCACCTGATCTCAGCCTATAC

TTTGCACATCACTCCTGCCTTGGGACCACATTCAAGCTCAGAGTTCTCCCCCTGTATATCACTATGAGTTTTTCTTTTCGAGAGTCATTTTAAAGATAGT

GGTATTATTATTATTTCCAAGCCATAGCTTGGGCTAAAAGGACACATTCAGAATGTCTGCCAATACCAAGGATAGTCTTGTGTATTTGAAAAGTAACTTA

TTATTGCAAGTATTGTGATTTTGTTTGCATTCAAAAGCTCTTGTTAGCTGTTATTTGTCTTAGTCTATAAAGCTGTCTGTGTGTGGTCTGAGCAGCAGTT

GTCATCCCAACACAGGTACGGAGATGTGACAGCATTGTAGCAGACACTCAGGTGGGAACAAGACACCCGTGCAGGTGCAGTGCAGGTGGCCAGCTCATCA

TGATGTGGGCTACAGCAGCCACAGGGGTCTCAGCAGTCTTTCGGAAAGGAGAACAAAGCGCAAGTAGGAAGAAAGAACTCTAATTTCCAAAGAAGGAAAG

ATTAACATTGAACTTGTTTCTGAAATGAACATCATGTTGCACCCAATTGTGAGGATACTACAAACCCACTGGCAGTGGCTTCTCAAAGGCTTTCTTTCTA

TAGAAACCCTAAGCTACCATTTCACAACACAAGTATGGAATCCCTAGATTAAAAGAAATATTGTAGGAGCTGGAGAGATGGCGAAGATACTCTTGCAGAG

GGCTGGATTTAATTTCAGCCCTCACATGGTGGCTTACAACTGCCTGCAACTCCACATCCAGGGGATCCGACACCCTCGTCTGACCTCCACAGGCACTTCA

TGCATGTGGCCCATAGGCATACATGCAGTCAGAATACCCCTACACACACAAAATAATAAGAAAAAAAAATTTATCATGGATGCAATAATGAAGTTTCCCT

TGGCTTGTGCTGTGACTTTACAGCACACAACCACATGTGCAATCATTGAACTTGAGCTTTGAGACCTCCACAGAGCTCAGTCCCCAAGAGATAGTAGACT

CATATAAGAGAGAGAGGCTAAAATAATGGAGGGGACTTCATCCTGGAAAGGACATCCTTTGTGACCTCCTGGACATGGCACTCTTAACTATATAATTCAA

ATCAGTGACTGCTTACTAAAAAAATGTACTTTTCACATTTTTACAAATTAAGTATAACATTTTGTATATATATATTTAAAGGTTTTGATTTGCTTTTTAA

TGTAAAGGCAAATAAGAGTTCATAAACTTCTGTAATTACAAAAAAAGCCAAAGCCATTGAAAGTGCACTGACCATGACAGCTTTGCTACAGAGCAGTCAT

GTTACCAACCGCCTTTTCAAGTTTGTACTTTTCCCTTACGCTCTCTTCCTGTTTTTCTGTCCAATCACTTGAGAGTCAGAACAGTTCCAAATGTAACAGT

ATTGTGTCTTCCCACAGAATGCCTGTCTCTAGGAAGCATAATGGCTGAAGATTCCCCTGGGGAGACAGTAACCCGGAAGCCTTAGACTTGAGCCCAGGTG

CCGAGCAGTGCAGTGAGGCGCAGCCTTACTGGCCCTTTGAGTGTCAGCTGCCACTTTACAGCCATGCTTCACTAATCTGGCCTATGAACTAACTGTGCTG

GTTTCTGATTGTGAATCTTTTTATTCACCTACTTGCAGATTGTTTTCATGTCCAAAACAAAAGAAATATTTTTGCTATATCCACCTTTGTAATCCAAGTT

TGAGTACTCATTGTCACCATTTTCTATCCATTGCTCCAGAAAAATGTGCTGTCTGCACAGCTTCTGTCTATCCACCAGGTCTTCAGACAGATGGACCCTT

GCCTGCCTTGGTCCTTAAAGGTGTACATTAAATGTCTTTCACAGAGAGTTAAGATCTGTGGCTTTGAACCTGCATTGTGTAGCTGCCTTGATTTTAATCA

AGCTTTATCTGTGAGTGTTCAGACCAACTGATCACATTGATCAGAATAAAAACCAAATGCTTTGTAGTTTGATGTGTATGAGTCCCTGAAAAAAATCATG

TCTGCCTTTTTTTTTACTTTGTTAGGTGACTAGAGCAAGGGAAGCCTTAAAGCCCATGATTGCTCCAGTTCTAAGCCCCCATTTGTCCTTGTTCTAAGTG

TGCAACATTACTAAACAGACTAGTGCCCAGCACCTGCCAAGACTGTCAAAGCAGGAGACTTTTAGTGCAGAGTTTTGCCAAATAATAAATTTCAACAAAA

TCTCAGAGTAAACCATTAAGAGATTAGTGAATCCAGCCACTGCTTACAGCAAGGTTACTCGGAATCACCAGATTTCATTTCCTCTAATTGATGTCTTTAT

AAATGATCTTTGGGGAAAAAAATCCTTTAGAGAGTATTCATGAGGGTGGCATGTTGGTTACCTCCATGATCTCTACCAAGCTGGAAGAGCAGGAATAGCC

ATAGGGTCACCTTATATAATTACAAAGAAAGAGGAAGGAAGAAAGGTTTCCTTAAACATTCAACCCAGTGATTATTTGGGTGGAAACATTCTAGAAGACG

CTGGGTGTGCCCGTGCAGCGTTCTGTTACACGCTACAGGCGGGGTCCACCGAGACAAGTCGGGTACATTTTCAAATCAAACTTGAGCCCCAGTCATCTTT

AGCTTTCTTGTTGTTTAAAAGGCCTCTTTATTTTTATTGTACAGAATGAATGCAGTTGAACTTGATAGATGTTTTAAAATTGAAATGTGAGTTTATCAAA

AACAAAAGCAAAATTGCACAGTTGCTATGATCAAGTGACAATTATCTGCACAATTCATTGATTGTAAGGCATCCTGTCACAAGCAATGTTGTCTCCTACT

TTCTGATGCCTCTTAAACTTATGTCTTTTAGAAAGACAGTGCCTCTGTATGCTTTGTATTTTTACTGAGTGTAAATACTTGTTATATTTTGGTTAAGAAA

ATGTAAGGGTATCATTTATTACCACATCTCCTAATACATCGGAACCAATAAAGAACATGCATC
Translation
MNSPVDPGARQALRKKPPERTPE - UNI1776 - DLNIIYSYLHGMEILSNLREHQLR - UNI20376 - RLMSTRARYERYSGNQMLFC - UNI

26947 - CSETIARCWYILLSGSVLVKDSMVLPPCS - UNI26947 - SFGKQFGGKRGCDCLVLEPSEMIV - UNI7121 - VENSKDNEDSIL

QREIPARQSRRRFRKINYKGERQTIIDGVDINNYLS - UNI1705 - - UNI7121 - LPADLTKMHLTDNPHPQVTHVSSSQSGCSIASDSGSSSL

SDIYQ - UNI1705 - ATESEVGDVDLTRLPEGPVDSEDEEEEEEEIDRTDPLQGRDLVRECLEKEPADKTDDDVE EQLLEFMHQLPAFANMTMSVR

RELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDYWRILNHVEKNT

HKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK - UNI8263 - 

VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDT KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEVESGSKAADAGL

KRGDQ VMEVNGQNFENITLAKALEILRNNTHLALTVKTNIFV VFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQEKGNKKIKANTV

SGGRNKIRKILDKTRFSILPPKLFS - UNI27755 - SDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSD DIPDQV

IRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR RYYLKNNMETETLCSDEDAQELLK

ESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKNFNSM

FAIIS SGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEG GNDSKVDGLVNFEKLRMIAKE

IRHIIRMTSANMDPAMMFRQR RSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMMSLQWEPAYGTL - 

UNI9694 - LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKDHVLS STSLPQKGLGPTEEVSVKKHTEDTI

SVASSLHSSPPASPQNSPRKG GYTLTPSSKCDNLSDSSHSEISSRSSIVSNGSVDSMSAAGQDERCSSHSLAVPEPTGALEKTDHPSGISDHSQLAHG 

GWMLSKPCLIKGVAVSSSLSSEEMSHEHVVLEAADSGRGSWTSCSSSSHDNFQSLQNQKSWDFLNSYRHMHLDDPIAEVEPTDCEPCACPKGCSRTCGQC

KGSLETNQLRQSWASSSSLSDTCEPNYGTVKRRVLESAPAEAPDGLEPRDTTDPVYKTVTSSTDKGLIV VYCVTSPKKGDRYREPPPTPPGYLGISLAD

LKEGPHPHLKPPDYSVAVQRSKMMLNSLSRLPPAPPSSHTSAWVPSKIGSQPQRHSHPKLADVADADSEADE - UNI22315 - ENEQVSAV
Transcript ENSMUST00000101206
Sequence
GTTCTCGGCCAGTCTCGCCCCCGCGCAGGCGTCTTTCTGGCCAGTCGCGCGTGGGCTGAGGCCCTGGGCGGGCGTTGCGAAGACTTGTTTGCTTGAGTTT

GGACCCTGCGACAGTTCTCATTTCCCTCCCGGTGGGGCTGGCGTACACCCGGAGCTGGAGAATGGGCAGCTAGACGCAGGCTAGGGAGCCTGTGGCTGCG

GACATGAACTCGCCCGTGGACCCCGGCGCTCGGCAGGCACTGAGGAAGAAGCCGCCCGAGCGGACTCCTGAG - UNI1776 - GACTTAAATATTATT

TATTCTTATCTGCATGGGATGGAAATACTATCAAACCTCAGGGAGCATCAGCTTAG - UNI20376 - GTTAATGTCTACAAGAGCACGCTATGAGAG

ATACAGTGGCAATCAAATGCTTTTTTG - UNI26947 - TTCAGAAACTATTGCCAGATGTTGGTATATCCTGCTTTCTGGATCTGTACTTGTAAAAG

ATTCTATGGTCCTTCCTCCTTGCAG - UNI26947 - TTTTGGTAAGCAGTTTGGAGGAAAAAGAGGATGTGATTGTCTTGTGTTAGAACCTTCAGAA

ATGATTGTG - UNI7121 - GTAGAGAATTCCAAAGATAATGAAGACAGTATTTTACAAAGAGAAATTCCTGCCAGACAGTCTCGACGAAGGTTTCGG

AAAATTAACTATAAAGGAGAACGCCAAACCATAATAGATGGAGTGGATATTAATAACTACCTTTCG - UNI1705 - - UNI7121 - CTTCCAGCT

GATCTTACCAAGATGCACCTCACAGACAACCCTCATCCACAGGTGACGCATGTGTCTTCTAGTCAGTCTGGCTGTAGCATTGCCAGTGACTCTGGGAGCA

GCAGTTTATCCGATATCTATCAG - UNI1705 - GCTACAGAGAGTGAAGTAGGAGATGTAGATTTAACACGCCTTCCAGAAGGACCTGTTGATTCTG

AGGATGAAGAGGAGGAGGAAGAAGAGATTGATAGAACAGATCCACTGCAGGGTCGAGATCTTGTTCGGGAGTGTCTTGAAAAGGAACCCGCAGACAAAAC

TGATGATGATGTTG AACAGTTACTTGAGTTCATGCACCAGCTGCCTGCCTTTGCGAACATGACCATGTCTGTAAGGAGAGAACTCTGCTCCGTCATGGT

TTTTGAAGTAGTAGAGCAGGCTGGGGCTGTTATTCTTGAAGATGGGCAAGAG CTTGACTCATGGTATGTCATTTTAAATGGCACTGTAGAAATTAGTCA

TCCAGATGGGAAAATAGAAAATCTCTTCATGGGAAATAGTTTTGGGATTGTCCCCACGCTGGATAAGCAGCACATGCATGGAGCTGTCAGGACCAAAGTC

GATGATTGTCAG TTTGTCTGCATAGCTCAACAAGACTATTGGAGAATTTTAAATCATGTGGAAAAAAATACTCACAAAGTTGAGGAAGAGGGAGAGATT

GTCATGGTACATGAGCACCGTGAGCTAGACCGGAGCGGAACCAGGAAAGGACACATTGTAATCAAG GCAACACCTGAGCGTCTCATCATGCATTTGATA

GAAGAACATTCTATTGTGGACCCAACATACATAGAAGATTTCCTCTTAACTTACAGGACATTTCTTGAAACTCCTTTGGATGTTGGGATCAAGCTTTTGG

AATGGTTTAAGATTGACAACCTAAGGGATAAG - UNI8263 - GTGACACGGATTGTACTCTTATGGGTAAATAATCATTTTAATGATTTTGAAGGTG

ATCCTGCTATGACTCAATTTCTAGAAGAATTTGAAAGAAATTTGGAAGATACA AAAATGAATGGTCACCTCAGGTTATTGAATATTGCCTGTGCTGCAA

AGGCTAAGTGGAGGCAAGTTGTACTGCAGAAGGCGTCCCGTGAGTCCCCGCTGCACTTCTGCCTTACTGGGGGCAGTGAGAAGGGATTTGGAGTCTTTGT

TGAAGAAGTAGAATCTGGTAGCAAAGCTGCTGACGCAGGACTGAAAAGGGGTGATCAG GTAATGGAAGTCAATGGACAAAACTTTGAGAATATTACACT

TGCTAAAGCCCTTGAAATTTTGAGAAATAATACTCATCTTGCACTTACTGTGAAGACCAACATTTTTG TGTTCAAAGAATTGCTCAGTAGGACTGAACA

AGAGAAATCTGGTGTTCCTCATATTCCCAAAATTGCTGAAAAAAAAAGTAATCGCCATTCAATTCAAGATGTCCCAGGGGATATGGAGCAGGCACCACAG

GAGAAAGGAAATAAGAAAATTAAAGCAAATACCGTTTCAGGTGGAAGAAACAAAATCAGGAAAATTTTGGATAAAACACGATTTAGTATCTTGCCTCCAA

AACTATTTAG - UNI27755 - TGACGGAGGCCTGAGTCAATCACAAGATGACAGCATTGTGGGAACCAGGCACTGTAGGCACAGCCTGGCTATAATG

CCAATTCCCGGAACACTTTCATCCAGCAGCCCAGATCTCTTACAGCCTACCACTAGCATGTTGGACTTTTCCAATCCTTCAG ATATTCCTGATCAAGTT

ATAAGAGTTTTCAAAGCAGATCAACAAAGTTGCTACATTATCATCAGTAAGGATACCACAGCTAAAGAAGTGGTCTGCCAAGCTGTACAGGAATTCGGTT

TGACTGGTGCATCTGACACATACTCCCTCTGTGAAGTGTCTGTTACTCCTGAGGGTGTTATAAAGCAGAGAAGACTTCCGGACCAGTTCTCCAAATTAGC

TGATAGAATTCAACTCAATGGAAG GTATTACCTAAAAAACAACATGGAAACAGAAACATTGTGTTCTGATGAAGATGCTCAGGAACTACTTAAGGAAAG

CCAGCTCTCCATGCTGCAGCTCAGTACCATCGAGGTCGCCACCCAGCTCTCCATGAGAGACTTTGATTTATTTCGTAACATTGAGCCTACTGAATACATT

GATGATCTTTTTAAATTAGATTCCAAAACAGGAAATACTCACTTGAAACAATTTGAGGATATTGTAAACCAAGAGACATTCTGGGTTGCCTCAGAGATTT

TAAGTGAGTCAAATCAGCTGAAAAGAATGAAGATTATTAAACATTTTATCAAAATTGCTCTTCATTGCCGAGAATGCAAGAATTTCAATTCCATGTTTGC

AATAATAAG TGGCTTGAACCTGGCACCGGTAGCACGACTCAGAGGCACTTGGGAAAAGTTGCCAAGCAAATATGAGAAACATCTTCAAGATCTACAAGA

CCTTTTTGATCCATCTAGAAATATGGCAAAATACAGAAATATTCTTAGTAGTCAAAGCATGCAGCCTCCAATTATTCCACTCTTCCCTGTTGTCAAGAAA

GATATGACATTTCTCCATGAAG GAAATGACTCCAAAGTAGATGGCTTAGTAAACTTCGAGAAGCTAAGAATGATTGCCAAGGAAATCCGTCATATTATT

CGAATGACTTCTGCCAACATGGACCCTGCCATGATGTTCCGACAGAG GAAGAAGAGGTGGCGGAGTCTGGG GTCATTGAGTCAAGGCAGCACAAATTC

TAACATGCTAGATGTCCAGGGAGGTGCTCACAAAAAAAGAGCACGCCGCAGCTCACTGCTGAATGCCAAGAAACTGTATGAAGATGCCCAAATGGCAAGG

AAAGTGAAACAGTATCTTTCTAGTCTGGACATAGACACAGATGAGGAGAAGTTCCAGATGATGTCACTGCAGTGGGAACCTGCATATGGTACCT - UNI

9694 - TGACAAAGAACTTAACTGAAAAAAGGTCAGCCAAATCATCTGAGATGTCTCCTGTACCATTGAGGTCAGTTGGCCAAACAGCTAAAGTCCACT

TGCATCAGCCACACAGAGTGAGCCAGGTGCTTCAGGTGCCAGCAGTTAACTTGCACCCCATCCGGAAGAAAGGACAAGCCAAAGACCATGTGCTGA GTA

CAAGTTTACCTCAGAAAGGTTTAGGACCAACTGAGGAAGTGAGTGTTAAGAAACACACAGAAGACACTATTTCTGTAGCGTCCTCTCTGCACTCTAGCCC

TCCTGCATCTCCTCAGAACTCCCCACGCAAAG GTTATACACTCACACCATCAAGTAAATGTGACAACTTGTCTGACTCCAGCCACAGTGAAATCTCCTC

TCGGTCCAGCATTGTGAGCAATGGTTCTGTTGACTCCATGTCTGCAGCTGGGCAGGATGAACGCTGTTCCTCCCACAGTCTGGCAGTTCCTGAGCCCACA

GGGGCATTGGAAAAGACAGATCACCCTTCCGGGATCTCAGACCACAGTCAGCTTGCTCACGG GTGGATGCTGTCAAAGCCGTGTCTTATCAAGGGTGTA

GCTGTCTCATCTTCTCTGAGCAGCGAAGAGATGTCTCATGAGCATGTTGTGCTGGAAGCAGCTGACAGTGGGCGGGGCAGTTGGACTTCCTGTTCCAGCA

GCTCCCATGACAACTTCCAAAGCCTTCAAAATCAAAAAAGCTGGGACTTCCTGAATTCTTACAGACACATGCATTTAGATGACCCTATTGCAGAAGTTGA

GCCCACTGACTGTGAGCCCTGTGCCTGTCCTAAAGGCTGCTCAAGAACTTGTGGCCAGTGCAAAGGCAGCCTAGAGACGAACCAGCTGAGGCAGAGTTGG

GCCTCCTCCAGCTCACTCTCGGACACATGTGAACCAAACTACGGGACAGTTAAGCGGAGGGTGTTGGAAAGTGCACCAGCAGAGGCACCTGATGGCTTGG

AGCCCAGGGATACCACTGACCCTGTTTATAAAACTGTCACTTCCAGTACAGACAAGGGCTTGATTG TGTACTGTGTCACCTCACCCAAGAAAGGTGATA

GGTATAGGGAGCCACCGCCCACTCCTCCAGGATATCTGGGAATTTCTTTAGCGGACCTAAAGGAAGGACCCCACCCGCACCTAAAACCTCCAGACTATAG

TGTGGCAGTACAGAGATCAAAGATGATGCTTAACAGCCTGTCTAGACTGCCGCCAGCTCCTCCCAGTAGCCACACCTCGGCCTGGGTTCCCTCGAAGATT

GGATCCCAGCCTCAAAGGCATAGCCATCCCAAGCTAGCAGATGTGGCTGATGCAGATAGCGAAGCAGATG - UNI22315 - AAAACGAGCAGGTGTC

AGCAGTCTAGCCTTTGGACAGAGTGTTGGAGAGCACTGGAAGTCAGGACCATGGACAAGAGCTCGTGGTTCTGTAGGCCAAGGCCATCAGCTCGCTGCTG

CCACTCATGCTGAGGGTTCCACACTGGGCTCTGAGGATGAGCTCTTCTGAGTCGTGCTTCCTTTTGTTCTGTCCCTGCAGGTGCAGTTTCCTTACCTGGG

TGTTGCACCTGATCTCAGCCTATACTTTGCACATCACTCCTGCCTTGGGACCACATTCAAGCTCAGAGTTCTCCCCCTGTATATCACTATGAGTTTTTCT

TTTCGAGAGTCATTTTAAAGATAGTGGTATTATTATTATTTCCAAGCCATAGCTTGGGCTAAAAGGACACATTCAGAATGTCTGCCAATACCAAGGATAG

TCTTGTGTATTTGAAAAGTAACTTATTATTGCAAGTATTGTGATTTTGTTTGCATTCAAAAGCTCTTGTTAGCTGTTATTTGTCTTAGTCTATAAAGCTG

TCTGTGTGTGGTCTGAGCAGCAGTTGTCATCCCAACACAGGTACGGAGATGTGACAGCATTGTAGCAGACACTCAGGTGGGAACAAGACACCCGTGCAGG

TGCAGTGCAGGTGGCCAGCTCATCATGATGTGGGCTACAGCAGCCACAGGGGTCTCAGCAGTCTTTCGGAAAGGAGAACAAAGCGCAAGTAGGAAGAAAG

AACTCTAATTTCCAAAGAAGGAAAGATTAACATTGAACTTGTTTCTGAAATGAACATCATGTTGCACCCAATTGTGAGGATACTACAAACCCACTGGCAG

TGGCTTCTCAAAGGCTTTCTTTCTATAGAAACCCTAAGCTACCATTTCACAACACAAGTATGGAATCCCTAGATTAAAAGAAATATTGTAGGAGCTGGAG

AGATGGCGAAGATACTCTTGCAGAGGGCTGGATTTAATTTCAGCCCTCACATGGTGGCTTACAACTGCCTGCAACTCCACATCCAGGGGATCCGACACCC

TCGTCTGACCTCCACAGGCACTTCATGCATGTGGCCCATAGGCATACATGCAGTCAGAATACCCCTACACACACAAAATAATAAGAAAAAAAAATTTATC

ATGGATGCAATAATGAAGTTTCCCTTGGCTTGTGCTGTGACTTTACAGCACACAACCACATGTGCAATCATTGAACTTGAGCTTTGAGACCTCCACAGAG

CTCAGTCCCCAAGAGATAGTAGACTCATATAAGAGAGAGAGGCTAAAATAATGGAGGGGACTTCATCCTGGAAAGGACATCCTTTGTGACCTCCTGGACA

TGGCACTCTTAACTATATAATTCAAATCAGTGACTGCTTACTAAAAAAATGTACTTTTCACATTTTTACAAATTAAGTATAACATTTTGTATATATATAT

TTAAAGGTTTTGATTTGCTTTTTAATGTAAAGGCAAATAAGAGTTCATAAACTTCTGTAATTACAAAAAAAGCCAAAGCCATTGAAAGTGCACTGACCAT

GACAGCTTTGCTACAGAGCAGTCATGTTACCAACCGCCTTTTCAAGTTTGTACTTTTCCCTTACGCTCTCTTCCTGTTTTTCTGTCCAATCACTTGAGAG

TCAGAACAGTTCCAAATGTAACAGTATTGTGTCTTCCCACAGAATGCCTGTCTCTAGGAAGCATAATGGCTGAAGATTCCCCTGGGGAGACAGTAACCCG

GAAGCCTTAGACTTGAGCCCAGGTGCCGAGCAGTGCAGTGAGGCGCAGCCTTACTGGCCCTTTGAGTGTCAGCTGCCACTTTACAGCCATGCTTCACTAA

TCTGGCCTATGAACTAACTGTGCTGGTTTCTGATTGTGAATCTTTTTATTCACCTACTTGCAGATTGTTTTCATGTCCAAAACAAAAGAAATATTTTTGC

TATATCCACCTTTGTAATCCAAGTTTGAGTACTCATTGTCACCATTTTCTATCCATTGCTCCAGAAAAATGTGCTGTCTGCACAGCTTCTGTCTATCCAC

CAGGTCTTCAGACAGATGGACCCTTGCCTGCCTTGGTCCTTAAAGGTGTACATTAAATGTCTTTCACAGAGAGTTAAGATCTGTGGCTTTGAACCTGCAT

TGTGTAGCTGCCTTGATTTTAATCAAGCTTTATCTGTGAGTGTTCAGACCAACTGATCACATTGATCAGAATAAAAACCAAATGCTTTGTAGTTTGATGT

GTATGAGTCCCTGAAAAAAATCATGTCTGCCTTTTTTTTTACTTTGTTAGGTGACTAGAGCAAGGGAAGCCTTAAAGCCCATGATTGCTCCAGTTCTAAG

CCCCCATTTGTCCTTGTTCTAAGTGTGCAACATTACTAAACAGACTAGTGCCCAGCACCTGCCAAGACTGTCAAAGCAGGAGACTTTTAGTGCAGAGTTT

TGCCAAATAATAAATTTCAACAAAATCTCAGAGTAAACCATTAAGAGATTAGTGAATCCAGCCACTGCTTACAGCAAGGTTACTCGGAATCACCAGATTT

CATTTCCTCTAATTGATGTCTTTATAAATGATCTTTGGGGAAAAAAATCCTTTAGAGAGTATTCATGAGGGTGGCATGTTGGTTACCTCCATGATCTCTA

CCAAGCTGGAAGAGCAGGAATAGCCATAGGGTCACCTTATATAATTACAAAGAAAGAGGAAGGAAGAAAGGTTTCCTTAAACATTCAACCCAGTGATTAT

TTGGGTGGAAACATTCTAGAAGACGCTGGGTGTGCCCGTGCAGCGTTCTGTTACACGCTACAGGCGGGGTCCACCGAGACAAGTCGGGTACATTTTCAAA

TCAAACTTGAGCCCCAGTCATCTTTAGCTTTCTTGTTGTTTAAAAGGCCTCTTTATTTTTATTGTACAGAATGAATGCAGTTGAACTTGATAGATGTTTT

AAAATTGAAATGTGAGTTTATCAAAAACAAAAGCAAAATTGCACAGTTGCTATGATCAAGTGACAATTATCTGCACAATTCATTGATTGTAAGGCATCCT

GTCACAAGCAATGTTGTCTCCTACTTTCTGATGCCTCTTAAACTTATGTCTTTTAGAAAGACAGTGCCTCTGTATGCTTTGTATTTTTACTGAGTGTAAA

TACTTGTTATATTTTGGTTAAGAAAATGTAAGGGTATCATTTATTACCACATCTCCTAATACATCGGAACCAATAAAGAACATGCATC
Translation
MNSPVDPGARQALRKKPPERTPE - UNI1776 - DLNIIYSYLHGMEILSNLREHQLR - UNI20376 - RLMSTRARYERYSGNQMLFC - UNI

26947 - CSETIARCWYILLSGSVLVKDSMVLPPCS - UNI26947 - SFGKQFGGKRGCDCLVLEPSEMIV - UNI7121 - VENSKDNEDSIL

QREIPARQSRRRFRKINYKGERQTIIDGVDINNYLS - UNI1705 - - UNI7121 - LPADLTKMHLTDNPHPQVTHVSSSQSGCSIASDSGSSSL

SDIYQ - UNI1705 - ATESEVGDVDLTRLPEGPVDSEDEEEEEEEIDRTDPLQGRDLVRECLEKEPADKTDDDVE EQLLEFMHQLPAFANMTMSVR

RELCSVMVFEVVEQAGAVILEDGQE LDSWYVILNGTVEISHPDGKIENLFMGNSFGIVPTLDKQHMHGAVRTKVDDCQ FVCIAQQDYWRILNHVEKNT

HKVEEEGEIVMVHEHRELDRSGTRKGHIVIK ATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLETPLDVGIKLLEWFKIDNLRDK - UNI8263 - 

VTRIVLLWVNNHFNDFEGDPAMTQFLEEFERNLEDT KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHFCLTGGSEKGFGVFVEEVESGSKAADAGL

KRGDQ VMEVNGQNFENITLAKALEILRNNTHLALTVKTNIFV VFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDMEQAPQEKGNKKIKANTV

SGGRNKIRKILDKTRFSILPPKLFS - UNI27755 - SDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSD DIPDQV

IRVFKADQQSCYIIISKDTTAKEVVCQAVQEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR RYYLKNNMETETLCSDEDAQELLK

ESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKNFNSM

FAIIS SGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEG GNDSKVDGLVNFEKLRMIAKE

IRHIIRMTSANMDPAMMFRQR RKKRWRSLG GSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMMSLQW

EPAYGTL - UNI9694 - LTKNLTEKRSAKSSEMSPVPLRSVGQTAKVHLHQPHRVSQVLQVPAVNLHPIRKKGQAKDHVLS STSLPQKGLGPTEEV

SVKKHTEDTISVASSLHSSPPASPQNSPRKG GYTLTPSSKCDNLSDSSHSEISSRSSIVSNGSVDSMSAAGQDERCSSHSLAVPEPTGALEKTDHPSGI

SDHSQLAHG GWMLSKPCLIKGVAVSSSLSSEEMSHEHVVLEAADSGRGSWTSCSSSSHDNFQSLQNQKSWDFLNSYRHMHLDDPIAEVEPTDCEPCACP

KGCSRTCGQCKGSLETNQLRQSWASSSSLSDTCEPNYGTVKRRVLESAPAEAPDGLEPRDTTDPVYKTVTSSTDKGLIV VYCVTSPKKGDRYREPPPTP

PGYLGISLADLKEGPHPHLKPPDYSVAVQRSKMMLNSLSRLPPAPPSSHTSAWVPSKIGSQPQRHSHPKLADVADADSEADE - UNI22315 - ENEQ

VSAV

For any suggestions or comments, please send an email to unitrap@crg.es