Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037601 (Nme1)
Chromosomal location
Chr 11: 93820547 - 93829586 (-)
Description
non-metastatic cells 1, protein (NM23A) expressed in Gene [Source:MGI (curated);Acc:Nme1-001]
RefSeq_dna
NM_008704 
RefSeq_peptide
NP_032730.1 
MGI
MGI:97355 
Uniprot/SWISSPROT
P15532 
Uniprot/SPTREMBL
Q5NC80 Q5NC81 Q5NC79 
Human Ortholog
not available
Omim not available
UniTrap UNI12165
Vector Insertion
Chr 11: 93829534 - 93829575
Public Clones W227C01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15046
Vector Insertion
Chr 11: 93827121 - 93829575
Public Clones E063D12 (ggtc) D039D02 (ggtc) D183G10 (ggtc) D051B06 (ggtc) PST14156-NL (escells)
IST14376A4 (tigm) IST14963H12 (tigm)
Private Clones OST464446 (lexicon) OST431838 (lexicon) OST429904 (lexicon) OST332316 (lexicon)
OST321470 (lexicon) OST304931 (lexicon) OST300865 (lexicon) OST259180 (lexicon)
OST249963 (lexicon) OST193932 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17175
Vector Insertion
Chr 11: 93827121 - 93827252
Public Clones not available
Private Clones OST448159 (lexicon) OST382469 (lexicon) OST355222 (lexicon) OST319512 (lexicon)
OST319027 (lexicon) OST316536 (lexicon) OST277645 (lexicon) OST277643 (lexicon)
OST276648 (lexicon) OST270810 (lexicon) OST262706 (lexicon) OST165526 (lexicon)
OST117596 (lexicon) OST109446 (lexicon) OST61028 (lexicon) OST37483 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2074
Vector Insertion
Chr 11: 93824643 - 93827121
Public Clones AD0717 (sanger) XT0285 (sanger) CMHD-GT_343C8-3 (cmhd) CMHD-GT_323D10-3 (cmhd)
Private Clones OST418590 (lexicon) OST336118 (lexicon) OST309330 (lexicon) OST309325 (lexicon)
OST300392 (lexicon) OST271443 (lexicon) OST246040 (lexicon) OST233799 (lexicon)
OST225083 (lexicon) OST213121 (lexicon) OST128206 (lexicon) OST84137 (lexicon)
OST81397 (lexicon) OST75058 (lexicon) OST44826 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1885
Vector Insertion
Chr 11: 93822150 - 93824540
Public Clones AY0672 (sanger) RRM028 (baygenomics) RRM029 (baygenomics) RRM030 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24762
Vector Insertion
Chr 11: 93822022 - 93822095
Public Clones not available
Private Clones OST207555 (lexicon) OST183861 (lexicon) OST36696 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21070
Vector Insertion
Chr 11: 93820828 - 93821981
Public Clones CMHD-GT_444H6-3 (cmhd)
Private Clones OST342070 (lexicon)
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000021220
Sequence
GGCAGTCGCAGCCGGCGGTAAAGCCTTGTCATCTGAAGGG - UNI12165 - - UNI15046 - - UNI17175 - GACCATGGCCAACAGTGAGC

GCACCTTCATTGCCATCAAGCCTGATGGGGTCCAGCGGGGGCTGGTGGGCGAGATCATCAAGCGGTTCGAGCAGAAGGGGTTCCGCCTTGTTGGTCTGAA

GTTTCTGCAG - UNI2074 - - UNI15046 - - UNI17175 - GCTTCAGAGGACCTTCTCAAGGAGCACTACACTGACCTGAAGGACCGCCCC

TTCTTTACTGGCCTGGTGAAATACATGCACTCAGGACCAGTGGTTGCTATG - UNI1885 - - UNI24762 - GTCTGGGAGGGTCTGAATGTGGT

GAAGACAGGCCGCGTGATGCTTGGAGAGACCAACCCCGCAGACTCTAAGCCTGGGACCATACGAGGAGACTTCTGCATCCAAGTTGGCAG - UNI2107

0 - GAACATCATTCATGGCAGCGATTCTGTAAAGAGCGCAGAGAAGGAGATCAGCTTGTGGTTTCAGCCTGAGGAGCTGGTGGAGTACAAGAGCTGTGC

GCAGAACTGGATCTATGAGTGACAGGACGGTGCTGGTTTTCTACCTGCTTACTCTTGTTCTCACAGGCAGGGGACCAGCAACCCTAGATATTTCTGGAAC

TTCTTTGACCTGGAAGGAACCTTTGGGAGCTGTGACTCCCTGTGCAGTGTTACGTGCCACTGTTAGATTAAAGTGTTTAATCTGT
Translation
 - UNI12165 - - UNI15046 - - UNI17175 - MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQ - UNI2074 - - UNI

15046 - - UNI17175 - ASEDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAM - UNI1885 - - UNI24762 - VWEGLNVVKTGRVMLGETN

PADSKPGTIRGDFCIQVGR - UNI21070 - RNIIHGSDSVKSAEKEISLWFQPEELVEYKSCAQNWIYE
Transcript ENSMUST00000107844
Sequence
GTTTCCGGTGCGGGCAGTCGCAGCCGGCGGTAAAGCCTTGTCATCTGAAGGG - UNI12165 - - UNI15046 - - UNI17175 - GACCATGG

CCAACAGTGAGCGCACCTTCATTGCCATCAAGCCTGATGGGGTCCAGCGGGGGCTGGTGGGCGAGATCATCAAGCGGTTCGAGCAGAAGGGGTTCCGCCT

TGTTGGTCTGAAGTTTCTGCAG - UNI2074 - - UNI15046 - - UNI17175 - GCTTCAGAGGACCTTCTCAAGGAGCACTACACTGACCTG

AAGGACCGCCCCTTCTTTACTGGCCTGGTGAAATACATGCACTCAGGACCAGTGGTTGCTATG - UNI1885 - GTTTTCTACCGAGAGAGGGTTTCT

CCCTTGACTGTATCTTCTGCTGTCCTTGGAGGTCTGGGAGGGTCTGAATGTGGTGAAGACAGGCCGCGTGATGCTTGGAGAGACCAACCCCGCAGACTCT

AAG
Translation
 - UNI12165 - - UNI15046 - - UNI17175 - MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQ - UNI2074 - - UNI

15046 - - UNI17175 - ASEDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAM - UNI1885 - VFYRERVSPLTVSSAVLGGLGGSECGEDRPRD

AWRDQPRRL

For any suggestions or comments, please send an email to unitrap@crg.es