Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037606 (Osbpl5)
Chromosomal location
Chr 7: 150874667 - 150927868 (-)
Description
oxysterol binding protein-like 5 Gene [Source:MGI (curated);Acc:Osbpl5-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35236
Vector Insertion
Chr 7: 150901570 - 150926247
Public Clones IST11129G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000020411
Sequence
CAATTTTGCTGAGACCTTGCCCCAGGGGACAGGGACCTTGTTTTCTTCTTTGAGTCCCTCAAGGACTGGCTCTAGCAACTGCTGATTTACTGGGTTCTAG

CAGCCACACCCAGCTTTTTGTTTGAGCTTGGGGCAGACCTAGCAGGCAGGCTGGTCTCCATCTGTGAAGCGGCCCACACTGCACACAGTCCTGCTGGAAG

GGCAGAGCCACCCCTCAGACCTCAAGAAGGCAGTTTCACCATGGCCCTGAGCATCTTGTCTGAGCAGTTCTGCATCCGAAGGCCTCGCCAG - UNI352

36 - AAGCCCCCCAGCACCCACACCATGAAGGAGGAGGCCTTTCTCCGGCGCCGTTTCTCGCTGTGTCCACCAGCTTCTACTCCACAGAAGACTGACCC

CCGGAAAGTCCCACGGAACCTGCTTCTGGGCTGCGAAAATGAGCTTGGTCCCATCACCCCAG - UNI35236 - GAAGGGACATGGAGTCCAACGGCC

CATCACAACCCAGAGATGAAGAGCCCCAGACCCCAGGCTCCGCCACGAAGGTGCCACTG GCTGAGTACAGGCTATGCAATGGATCTGACAAGGAATGTA

CCTCTCCAACGACCAGGGTCTCCAAGAAGGATGCTCTCAAG GCACAGAAGGAGAACTATCGGCAGGAGAAGAAGCGGGCCACGAAGCAGCTGTTCAGTG

CCCTGACTGACCCCAGTGTGGTCATCATGGCTGACAGCCTAAAG ATCCGAGGGACCCTGAAGAGCTGGACGAAGCTGTGGTGTGTACTGAAGCCAGGGG

TGCTGCTCATTTACAAGACACCCAAGGTGGGCCAGTGGGTGGGCACGGTGCTGCTGCACTGCTGCGAGCTTATTGAGCGCCCCTCCAAGAAGGACGGCTT

CTGCTTCAAACTCTTCCACCCGCTGGACCAGTCTGTGTGGGCTGTGAAG GGCCCCAAAGGCGAGAGTGTGGGCTCCATCACTCAGCCCCTCCCTAGCAG

CTACCTGATCTTCAGGGCCGCTTCTGAATCAGACG GCCGCTGCTGGCTAGATGCCCTGGAGCTGGCCCTTCGCTGCTCCAGCCTCCTGCGACTGAGCAC

GTGCAAGCAGGGTCGAGATGGGGAGCAGGGGTCCTCGCCTGATGCCTCTCCCTCTTCTCTCTACGGACTGCCCACCTCGGCCACCATCCCAGATCAAGAC

CTGTTCCC GCTGAATGGGTCTGCCTTGGAGAACGATGCATTCTCAGACAAGTCAGAACGAGAGAATGCAGAAGACTCGGATGCCGAGACCCAGGATCAC

AGCCGCAAGACCAACGAGAGTGGGAGCGACCTGCTAGACAGCCCTGGTGGGCCATGGAGGGGAACTACCTATGTGGAACAGGTCCAGGAGGAGCTGGGAG

AG CTGGACGAGACTTCCCAGGTGGAGACAGTGTCAGAGGAAAACAAGAGCCTGATGTGGGTGCTGCTGCGACAGCTGCGGCCAGGCATGGACCTGTCCC

GTGTGGTGCTGCCGACCTTCGTGTTGGAGCCTCGGTCCTTCCTCGGCAAGCTCTCTGATTACTACTACCACGGAGACCTGCTCTCCAG GGCAGCAGCAG

AGGATGACCCCTACTGCCGCATGAAGCTTGTGCTCCGGTGGTACCTGTCTGGCTTCTATAAGAAGCCCAAG GGCATCAAGAAACCCTATAATCCCATTC

TGGGGGAGACTTTTCGCTGCCGCTGGCTGCACCCTCAGACCAACAGTCACACCTTCTACATAGCAGAACAG GTGTCTCACCATCCTCCTGTGTCTGCCT

TCTATGTCAGCAACAGGAAAGATGGCTTCTGCATGAGTGGCAGCATCACAGCAAAGTCTAAGTTCTATG GGAACTCATTGTCGGCGCTTCTGGACGGCA

AGGCTAAACTCACCTTCCTTAATCGCAAGGAGGAGTATACCCTCACCATGCCCTATGCCCACTGCCGAG GGATCCTCTACGGCACCATGACCATGGAGC

TGGGAGGCAAAGTGAACATCGAGTGTGAGAAGAACAACCTCCAAGCTGAACTGGACTTCAAGCTCAAG CCTTTCTTTGGAAGCAGCGCCAACATCAACC

AGATTTCCGGGAAGATCATGTCAGGAGAGGAAGTCCTGGCACGCCTCACTGGACACTGG GACAGAGATGTATTTATCAAGGAAGAGAGCAGTGGAGGCA

CCGAGCTCTTCTGGACTCCGAGTGAGGAGGTCCGCAGGCAGCGGCTGAAGCGGCACACAGTGCTGTTGGAAGAGCAGAGTGAACTGGAGTCTGAGAG GC

TGTGGCAGCATGTCACCAGGGCCATCCGTGAGGGTGACCAGCACAAAGCCACACAGGAGAAGTCTGTGCTGGAAGAGGCGCAGCGGCAGCGTGCCCGTGA

GCACCAGCAGAGCCTCACTCCATGGAAGCCACAGTTGTTCTTACTGGACCCTCTCACTCAGGAATGGCGCTACCGATATGAGGA CCTCAGCCCCTGGGA

CCCGCTGAAGGACATTGCCCAATATGAGCAAGATGGGATTCTTCATACTCTACAGAGGGAGACTATGTCTGGCCAGACAACCTTTCTGGGGAGTCCTGAC

TCCAGGCACAAG AGGCCTAGCTCTGATCGGCGGCTCCGCAAAGCCAGTGACCAGCCCTCTGGCCATAGCCAGGTCACTGAGAGCAGCGGCTCCACACCT

GAGTCCTGCCCAGACCTCTCTGATGAGGACTTTGTTCCTG GTGGTGAGAGCCCATGTCCTCGGTGCAGGCGAGAGGTACACCGGCTAAAGATGCTACAA

GAGGCCGTGCTGTCCATTCAGGAAGCTCAGCAAGAGCTGCATAG GCACCTTTCGACCATGTTAAGCTCCACAGTGCGTGCTGGGCAGGCGCCAGCCCCC

AGCCTCCTGCAGAATCCCCGCTCCTGGTTCCTGCTCTGCATCTTCCTGACGTGTCAGCTATTCATTAACTATATCCTCAAATAAGAGCCCTTGGAATCAG

CAAGGTGACGCCTGCAGAACTCCCTCCTAGGCACCCAGCACTTTACACCGGCCTGCAGAGGCAGTGGGGCCCACAGGCATGGCCAGTGGGACAGAAGGGT

CCTCGCACAAGAGGATGACAGGTGGGGCCTGGGGCTATGAGGGTGCTGTGACTCCAGCTGTAGGACCCTCCAGGGAGCACTGGCCTCTTCTTTGGAGCCC

TCCACCTAGTACCGGCCTTAACGCTAAAGCCAAATGCAGTTTCTGCCCTGCAGTGTGCCCCTGGTAATCTCAAGTTGCACTCCCAAGCCAGCCCCCACTT

GCCATACGGCATCAGATCTGGGGGTCAGGAGGGCCTGTGCAGGCTTTGGACAGCCACTTACCACAGCACAGGAGAGAGTGAGGTTGCCAGGAGCAGCAGG

AAGGAAGACTCCAGGATTCCCCGGAGCTCTTTGGGTGGTAATGTTGACTTCTGGACAATCTGCCCACCTTGTGCTCACACAAGCATGGACAGGCTGTAGC

TACTCTGGTGAGGACACTGGGACTTTTATCCTGTTGTTAAGCTGTTTCCACAGAAGCCTGTTCAGGTAGTTACTTCACCTACATCTGCCCTACAGCCAGA

GGAGCCCACCTGTGCCACAGGAGTGCCCTGGCCAACTGCAGTGTGAGTTTGTAAGCAAGAGAAGTGCCCAGAGGCTGACCCCAAAGGCCAGGGAGGCCCA

AGCTTGCCACTCTCCCTGACCAATACAGTCTTCCCATTCTGTTGACATTCTGACTACATAGAATTGCAATATCTGAGGCAGCTATGTGCAGTGAGCAGCC

TCTGCATCCAGCCCCTGATCCTATGTGGATGACGCTCTTCGTGTGCGTGTGTGTGTGTGTGCGTGTGTATGTATGTGAGCACCTATGCGTACTCACATTT

GGAGCCTTAATACTTAGTTGGTGCCATCTCCATTGTATCTGATCCTTTCATTTTCCAAGTTTTGTATCCATTTGTCTCTGTCCTTCCCCAATCCTGGGGG

TATGTCTGCTCCATGCCTTGAAATAAATGGAAATACATGTA
Translation
MALSILSEQFCIRRPRQ - UNI35236 - KPPSTHTMKEEAFLRRRFSLCPPASTPQKTDPRKVPRNLLLGCENELGPITPG - UNI35236 - GR

DMESNGPSQPRDEEPQTPGSATKVPL AEYRLCNGSDKECTSPTTRVSKKDALK AQKENYRQEKKRATKQLFSALTDPSVVIMADSLK IRGTLKSWTK

LWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVK GPKGESVGSITQPLPSSYLIFRAASESDG GRCWLDALELA

LRCSSLLRLSTCKQGRDGEQGSSPDASPSSLYGLPTSATIPDQDLFP PLNGSALENDAFSDKSERENAEDSDAETQDHSRKTNESGSDLLDSPGGPWRG

TTYVEQVQEELGE LDETSQVETVSEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPRSFLGKLSDYYYHGDLLSR RAAAEDDPYCRMKLVLRWYLSGF

YKKPK GIKKPYNPILGETFRCRWLHPQTNSHTFYIAEQ VSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYG GNSLSALLDGKAKLTFLNRKEEYTLT

MPYAHCRG GILYGTMTMELGGKVNIECEKNNLQAELDFKLK PFFGSSANINQISGKIMSGEEVLARLTGHW DRDVFIKEESSGGTELFWTPSEEVRR

QRLKRHTVLLEEQSELESER RLWQHVTRAIREGDQHKATQEKSVLEEAQRQRAREHQQSLTPWKPQLFLLDPLTQEWRYRYED DLSPWDPLKDIAQYE

QDGILHTLQRETMSGQTTFLGSPDSRHK RPSSDRRLRKASDQPSGHSQVTESSGSTPESCPDLSDEDFVPG GGESPCPRCRREVHRLKMLQEAVLSIQ

EAQQELHR RHLSTMLSSTVRAGQAPAPSLLQNPRSWFLLCIFLTCQLFINYILK
Transcript ENSMUST00000035523
Sequence
CAATTTTGCTGAGACCTTGCCCCAGGGGACAGGGACCTTGTTTTCTTCTTTGAGTCCCTCAAGGACTGGCTCTAGCAACTGCTGATTTACTGGGTTCTAG

CAGCCACACCCAGCTTTTTGTTTGAGCTTGGGGCAGACCTAGCAGGCAGGCTGGTCTCCATCTGTGAAGCGGCCCACACTGCACACAGTCCTGCTGGAAG

GGCAGAGCCACCCCTCAGACCTCAAGAAGGCAGTTTCACCATGGCCCTGAGCATCTTGTCTGAGCAGTTCTGCATCCGAAGGCCTCGCCAG - UNI352

36 - AAGCCCCCCAGCACCCACACCATGAAGGAGGAGGCCTTTCTCCGGCGCCGTTTCTCGCTGTGTCCACCAGCTTCTACTCCACAGAAGACTGACCC

CCGGAAAGTCCCACGGAACCTGCTTCTGGGCTGCGAAAATGAGCTTGGTCCCATCACCCCAG - UNI35236 - GAAGGGACATGGAGTCCAACGGCC

CATCACAACCCAGAGATGAAGAGCCCCAGACCCCAGGCTCCGCCACGAAGGTGCCACTG GCTGAGTACAGGCTATGCAATGGATCTGACAAGGAATGTA

CCTCTCCAACGACCAGGGTCTCCAAGAAGGATGCTCTCAAG GCACAGAAGGAGAACTATCGGCAGGAGAAGAAGCGGGCCACGAAGCAGCTGTTCAGTG

CCCTGACTGACCCCAGTGTGGTCATCATGGCTGACAGCCTAAAG ATCCGAGGGACCCTGAAGAGCTGGACGAAGCTGTGGTGTGTACTGAAGCCAGGGG

TGCTGCTCATTTACAAGACACCCAAGGTGGGCCAGTGGGTGGGCACGGTGCTGCTGCACTGCTGCGAGCTTATTGAGCGCCCCTCCAAGAAGGACGGCTT

CTGCTTCAAACTCTTCCACCCGCTGGACCAGTCTGTGTGGGCTGTGAAG GGCCCCAAAGGCGAGAGTGTGGGCTCCATCACTCAGCCCCTCCCTAGCAG

CTACCTGATCTTCAGGGCCGCTTCTGAATCAGACG GCCGCTGCTGGCTAGATGCCCTGGAGCTGGCCCTTCGCTGCTCCAGCCTCCTGCGACTGAGCAC

GTGCAAGCAGGGTCGAGATGGGGAGCAGGGGTCCTCGCCTGATGCCTCTCCCTCTTCTCTCTACGGACTGCCCACCTCGGCCACCATCCCAGATCAAGAC

CTGTTCCC GCTGAATGGGTCTGCCTTGGAGAACGATGCATTCTCAGACAAGTCAGAACGAGAGAATGCAGAAGACTCGGATGCCGAGACCCAGGATCAC

AGCCGCAAGACCAACGAGAGTGGGAGCGACCTGCTAGACAGCCCTGGTGGGCCATGGAGGGGAACTACCTATGTGGAACAGGTCCAGGAGGAGCTGGGAG

AG CTGGACGAGACTTCCCAGGTGGAGACAGTGTCAGAGGAAAACAAGAGCCTGATGTGGGTGCTGCTGCGACAGCTGCGGCCAGGCATGGACCTGTCCC

GTGTGGTGCTGCCGACCTTCGTGTTGGAGCCTCGGTCCTTCCTCGGCAAGCTCTCTGATTACTACTACCACGGAGACCTGCTCTCCAG GGCAGCAGCAG

AGGATGACCCCTACTGCCGCATGAAGCTTGTGCTCCGGTGGTACCTGTCTGGCTTCTATAAGAAGCCCAAG GGCATCAAGAAACCCTATAATCCCATTC

TGGGGGAGACTTTTCGCTGCCGCTGGCTGCACCCTCAGACCAACAGTCACACCTTCTACATAGCAGAACAG GTGTCTCACCATCCTCCTGTGTCTGCCT

TCTATGTCAGCAACAGGAAAGATGGCTTCTGCATGAGTGGCAGCATCACAGCAAAGTCTAAGTTCTATG GGAACTCATTGTCGGCGCTTCTGGACGGCA

AGGCTAAACTCACCTTCCTTAATCGCAAGGAGGAGTATACCCTCACCATGCCCTATGCCCACTGCCGAG GGATCCTCTACGGCACCATGACCATGGAGC

TGGGAGGCAAAGT AGATGTATTTATCAAGGAAGAGAGCAGTGGAGGCACCGAGCTCTTCTGGACTCCGAGTGAGGAGGTCCGCAGGCAGCGGCTGAAGC

GGCACACAGTGCTGTTGGAAGAGCAGAGTGAACTGGAGTCTGAGAG GCTGTGGCAGCATGTCACCAGGGCCATCCGTGAGGGTGACCAGCACAAAGCCA

CACAGGAGAAGTCTGTGCTGGAAGAGGCGCAGCGGCAGCGTGCCCGTGAGCACCAGCAGAGCCTCACTCCATGGAAGCCACAGTTGTTCTTACTGGACCC

TCTCACTCAGGAATGGCGCTACCGATATGAGGA CCTCAGCCCCTGGGACCCGCTGAAGGACATTGCCCAATATGAGCAAGATGGGATTCTTCATACTCT

ACAGAGGGAGACTATGTCTGGCCAGACAACCTTTCTGGGGAGTCCTGACTCCAGGCACAAG AGGCCTAGCTCTGATCGGCGGCTCCGCAAAGCCAGTGA

CCAGCCCTCTGGCCATAGCCAGGTCACTGAGAGCAGCGGCTCCACACCTGAGTCCTGCCCAGACCTCTCTGATGAGGACTTTGTTCCTG GTGGTGAGAG

CCCATGTCCTCGGTGCAGGCGAGAGGTACACCGGCTAAAGATGCTACAAGAGGCCGTGCTGTCCATTCAGGAAGCTCAGCAAGAGCTGCATAG GCACCT

TTCGACCATGTTAAGCTCCACAGTGCGTGCTGGGCAGGCGCCAGCCCCCAGCCTCCTGCAGAATCCCCGCTCCTGGTTCCTGCTCTGCATCTTCCTGACG

TGTCAGCTATTCATTAACTATATCCTCAAATAAGAGCCCTTGGAATCAGCAAGGTGACGCCTGCAGAACTCCCTCCTAGGCACCCAGCACTTTACACCGG

CCTGCAGAGGCAGTGGGGCCCACAGGCATGGCCAGTGGGACAGAAGGGTCCTCGCACAAGAGGATGACAGGTGGGGCCTGGGGCTATGAGGGTGCTGTGA

CTCCAGCTGTAGGACCCTCCAGGGAGCACTGGCCTCTTCTTTGGAGCCCTCCACCTAGTACCGGCCTTAACGCTAAAGCCAAATGCAGTTTCTGCCCTGC

AGTGTGCCCCTGGTAATCTCAAGTTGCACTCCCAAGCCAGCCCCCACTTGCCATACGGCATCAGATCTGGGGGTCAGGAGGGCCTGTGCAGGCTTTGGAC

AGCCACTTACCACAGCACAGGAGAGAGTGAGGTTGCCAGGAGCAGCAGGAAGGAAGACTCCAGGATTCCCCGGAGCTCTTTGGGTGGTAATGTTGACTTC

TGGACAATCTGCCCACCTTGTGCTCACACAAGCATGGACAGGCTGTAGCTACTCTGGTGAGGACACTGGGACTTTTATCCTGTTGTTAAGCTGTTTCCAC

AGAAGCCTGTTCAGGTAGTTACTTCACCTACATCTGCCCTACAGCCAGAGGAGCCCACCTGTGCCACAGGAGTGCCCTGGCCAACTGCAGTGTGAGTTTG

TAAGCAAGAGAAGTGCCCAGAGGCTGACCCCAAAGGCCAGGGAGGCCCAAGCTTGCCACTCTCCCTGACCAATACAGTCTTCCCATTCTGTTGACATTCT

GACTACATAGAATTGCAATATCTGAGGCAGCTATGTGCAGTGAGCAGCCTCTGCATCCAGCCCCTGATCCTATGTGGATGACGCTCTTCGTGTGCGTGTG

TGTGTGTGTGCGTGTGTATGTATGTGAGCACCTATGCGTACTCACATTTGGAGCCTTAATACTTAGTTGGTGCCATCTCCATTGTATCTGATCCTTTCAT

TTTCCAAGTTTTGTATCCATTTGTCTCTGTCCTTCCCCAATCCTGGGGGTATGTCTGCTCCATGCCTTGAAATAAATGGAAATACATGTA
Translation
MALSILSEQFCIRRPRQ - UNI35236 - KPPSTHTMKEEAFLRRRFSLCPPASTPQKTDPRKVPRNLLLGCENELGPITPG - UNI35236 - GR

DMESNGPSQPRDEEPQTPGSATKVPL AEYRLCNGSDKECTSPTTRVSKKDALK AQKENYRQEKKRATKQLFSALTDPSVVIMADSLK IRGTLKSWTK

LWCVLKPGVLLIYKTPKVGQWVGTVLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVK GPKGESVGSITQPLPSSYLIFRAASESDG GRCWLDALELA

LRCSSLLRLSTCKQGRDGEQGSSPDASPSSLYGLPTSATIPDQDLFP PLNGSALENDAFSDKSERENAEDSDAETQDHSRKTNESGSDLLDSPGGPWRG

TTYVEQVQEELGE LDETSQVETVSEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPRSFLGKLSDYYYHGDLLSR RAAAEDDPYCRMKLVLRWYLSGF

YKKPK GIKKPYNPILGETFRCRWLHPQTNSHTFYIAEQ VSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYG GNSLSALLDGKAKLTFLNRKEEYTLT

MPYAHCRG GILYGTMTMELGGKV VDVFIKEESSGGTELFWTPSEEVRRQRLKRHTVLLEEQSELESER RLWQHVTRAIREGDQHKATQEKSVLEEAQ

RQRAREHQQSLTPWKPQLFLLDPLTQEWRYRYED DLSPWDPLKDIAQYEQDGILHTLQRETMSGQTTFLGSPDSRHK RPSSDRRLRKASDQPSGHSQV

TESSGSTPESCPDLSDEDFVPG GGESPCPRCRREVHRLKMLQEAVLSIQEAQQELHR RHLSTMLSSTVRAGQAPAPSLLQNPRSWFLLCIFLTCQLFI

NYILK
Transcript ENSMUST00000119499
Sequence
CTCAGCGACAGCTGAGCCCCTCGCGGGCCCAGGCGGCCCGGCCCGGCCCCAGCACTGAGTACAACCAGCACG - UNI35236 - AAGCCCCCCAGCAC

CCACACCATGAAGGAGGAGGCCTTTCTCCGGCGCCGTTTCTCGCTGTGTCCACCAGCTTCTACTCCACAGAAGACTGACCCCCGGAAAGTCCCACGGAAC

CTGCTTCTGGGCTGCGAAAATGAGCTTGGTCCCATCACCCCAG - UNI35236 - GAAGGGACATGGAGTCCAACGGCCCATCACAACCCAGAGATGA

AGAGCCCCAGACCCCAGGCTCCGCCACGAAGGTGCCACTG GCTGAGTACAGGCTATGCAATGGATCTGACAAGGAATGTACCTCTCCAACGACCAGGGT

CTCCAAGAAGGATGCTCTCAAG GCACAGAAGGAGAACTATCGGCAGGAGAAGAAGCGGGCCACGAAGCAGCTGTTCAGTGCCCTGACTGACCCCAGTGT

GGTCATCATGGCTGACAGCCTAAAG ATCCGAGGGACCCTGAAGAGCTGGACGAAGCTGTGGTGTGTACTGAAGCCAGGGGTGCTGCTCATTTACAAGAC

ACCCAAGGTGGGCCAGTGGGTGGGCACGGTGCTGCTGCACTGCTGCGAGCTTATTGAGCGCCCCTCCAAGAAGGACGGCTTCTGCTTCAAACTCTTCCAC

CCGCTGGACCAGTCTGTGTGGGCTGTGAAG GGCCCCAAAGGCGAGAGTGTGGGCTCCATCACTCAGCCCCTCCCTAGCAGCTACCTGATCTTCAGGGCC

GCTTCTGAATCAGACG GCCGCTGCTGGCTAGATGCCCTGGAGCTGGCCCTTCGCTGCTCCAGCCTCCTGCGACTGAGCACGTGCAAGCAGGGTCGAGAT

GGGGAGCAGGGGTCCTCGCCTGATGCCTCTCCCTCTTCTCTCTACGGACTGCCCACCTCGGCCACCATCCCAGATCAAGACCTGTTCCC GCTGAATGGG

TCTGCCTTGGAGAACGATGCATTCTCAGACAAGTCAGAACGAGAGAATGCAGAAGACTCGGATGCCGAGACCCAGGATCACAGCCGCAAGACCAACGAGA

GTGGGAGCGACCTGCTAGACAGCCCTGGTGGGCCATGGAGGGGAACTACCTATGTGGAACAGGTCCAGGAGGAGCTGGGAGAG CTGGACGAGACTTCCC

AGGTGGAGACAGTGTCAGAGGAAAACAAGAGCCTGATGTGGGTGCTGCTGCGACAGCTGCGGCCAGGCATGGACCTGTCCCGTGTGGTGCTGCCGACCTT

CGTGTTGGAGCCTCGGTCCTTCCTCGGCAAGCTCTCTGATTACTACTACCACGGAGACCTGCTCTCCAG GGCAGCAGCAGAGGATGACCCCTACTGCCG

CATGAAGCTTGTGCTCCGGTGGTACCTGTCTGGCTTCTATAAGAAGCCCAAG GGCATCAAGAAACCCTATAATCCCATTCTGGGGGAGACTTTTCGCTG

CCGCTGGCTGCACCCTCAGACCAACAGTCACACCTTCTACATAGCAGAACAG GTGTCTCACCATCCTCCTGTGTCTGCCTTCTATGTCAGCAACAGGAA

AGATGGCTTCTGCATGAGTGGCAGCATCACAGCAAAGTCTAAGTTCTATG GGAACTCATTGTCGGCGCTTCTGGACGGCAAGGCTAAACTCACCTTCCT

TAATCGCAAGGAGGAGTATACCCTCACCATGCCCTATGCCCACTGCCGAG GGATCCTCTACGGCACCATGACCATGGAGCTGGGAGGCAAAGTGAACAT

CGAGTGTGAGAAGAACAACCTCCAAGCTGAACTGGACTTCAAGCTCAAG CCTTTCTTTGGAAGCAGCGCCAACATCAACCAGATTTCCGGGAAGATCAT

GTCAGGAGAGGAAGTCCTGGCACGCCTCACTGGACACTGG GACAGAGATGTATTTATCAAGGAAGAGAGCAGTGGAGGCACCGAGCTCTTCTGGACTCC

GAGTGAGGAGGTCCGCAGGCAGCGGCTGAAGCGGCACACAGTGCTGTTGGAAGAGCAGAGTGAACTGGAGTCTGAGAG GCTGTGGCAGCATGTCACCAG

GGCCATCCGTGAGGGTGACCAGCACAAAGCCACACAGGAGAAGTCTGTGCTGGAAGAGGCGCAGCGGCAGCGTGCCCGTGAGCACCAGCAGAGCCTCACT

CCATGGAAGCCACAGTTGTTCTTACTGGACCCTCTCACTCAGGAATGGCGCTACCGATATGAGGA CCTCAGCCCCTGGGACCCGCTGAAGGACATTGCC

CAATATGAGCAAGATGGGATTCTTCATACTCTACAGAGGGAGACTATGTCTGGCCAGACAACCTTTCTGGGGAGTCCTGACTCCAGGCACAAG AGGCCT

AGCTCTGATCGGCGGCTCCGCAAAGCCAGTGACCAGCCCTCTGGCCATAGCCAGGTCACTGAGAGCAGCGGCTCCACACCTGAGTCCTGCCCAGACCTCT

CTGATGAGGACTTTGTTCCTG GTGGTGAGAGCCCATGTCCTCGGTGCAGGCGAGAGGTACACCGGCTAAAGATGCTACAAGAGGCCGTGCTGTCCATTC

AGGAAGCTCAGCAAGAGCTGCATAG GCACCTTTCGACCATGTTAAGCTCCACAGTGCGTGCTGGGCAGGCGCCAGCCCCCAGCCTCCTGCAGAATCCCC

GCTCCTGGTTCCTGCTCTGCATCTTCCTGACGTGTCAGCTATTCATTAACTATATCCTCAAATAAGAGCCCTTGGAATCAGCAAGGTGACGCCTGCAGAA

CTCCCTCCTAGGCACCCAGCACTTTACACCGGCCTGCAGAGGCAGTGGGGCCCACAGGCATGGCCAGTGGGACAGAAGGGTCCTCGCACAAGAGGATGAC

AGGTGGGGCCTGGGGCTATGAGGGTGCTGTGACTCCAGCTGTAGGACCCTCCAGGGAGCACTGGCCTCTTCTTTGGAGCCCTCCACCTAGTACCGGCCTT

AACGCTAAAGCCAAATGCAGTTTCTGCCCTGCAGTGTGCCCCTGGTAATCTCAAGTTGCACTCCCAAGCCAGCCCCCACTTGCCATACGGCATCAGATCT

GGGGGTCAGGAGGGCCTGTGCAGGCTTTGGACAGCCACTTACCACAGCACAGGAGAGAGTGAGGTTGCCAGGAGCAGCAGGAAGGAAGACTCCAGGATTC

CCCGGAGCTCTTTGGGTGGTAATGTTGACTTCTGGACAATCTGCCCACCTTGTGCTCACACAAGCATGGACAGGCTGTAGCTACTCTGGTGAGGACACTG

GGACTTTTATCCTGTTGTTAAGCTGTTTCCACAGAAGCCTGTTCAGGTAGTTACTTCACCTACATCTGCCCTACAGCCAGAGGAGCCCACCTGTGCCACA

GGAGTGCCCTGGCCAACTGCAGTGTGAGTTTGTAAGCAAGAGAAGTGCCCAGAGGCTGACCCCAAAGGCCAGGGAGGCCCAAGCTTGCCACTCTCCCTGA

CCAATACAGTCTTCCCATTCTGTTGACATTCTGACTACATAGAATTGCAATATCTGAGGCAGCTATGTGCAGTGAGCAGCCTCTGCATCCAGCCCCTGAT

CCTATGTGGATGACGCTCTTCGTGTGCGTGTGTGTGTGTGTGCGTGTGTATGTATGTGAGCACCTATGCGTACTCACATTTGGAGCCTTAATACTTAGTT

GGTGCCATCTCCATTGTATCTGATCCTTTCATTTTCCAAGTTTTGTATCCATTTGTCTCTGTCCTTCCCCAATCCTGGGGGTATGTCTGCTCCATGCCTT

GAAATAAATGGAAATACATGTA
Translation
 - UNI35236 - MKEEAFLRRRFSLCPPASTPQKTDPRKVPRNLLLGCENELGPITPG - UNI35236 - GRDMESNGPSQPRDEEPQTPGSATKV

PL AEYRLCNGSDKECTSPTTRVSKKDALK AQKENYRQEKKRATKQLFSALTDPSVVIMADSLK IRGTLKSWTKLWCVLKPGVLLIYKTPKVGQWVGT

VLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVK GPKGESVGSITQPLPSSYLIFRAASESDG GRCWLDALELALRCSSLLRLSTCKQGRDGEQGSSP

DASPSSLYGLPTSATIPDQDLFP PLNGSALENDAFSDKSERENAEDSDAETQDHSRKTNESGSDLLDSPGGPWRGTTYVEQVQEELGE LDETSQVETV

SEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPRSFLGKLSDYYYHGDLLSR RAAAEDDPYCRMKLVLRWYLSGFYKKPK GIKKPYNPILGETFRCRW

LHPQTNSHTFYIAEQ VSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYG GNSLSALLDGKAKLTFLNRKEEYTLTMPYAHCRG GILYGTMTMELGGKV

NIECEKNNLQAELDFKLK PFFGSSANINQISGKIMSGEEVLARLTGHW DRDVFIKEESSGGTELFWTPSEEVRRQRLKRHTVLLEEQSELESER RLW

QHVTRAIREGDQHKATQEKSVLEEAQRQRAREHQQSLTPWKPQLFLLDPLTQEWRYRYED DLSPWDPLKDIAQYEQDGILHTLQRETMSGQTTFLGSPD

SRHK RPSSDRRLRKASDQPSGHSQVTESSGSTPESCPDLSDEDFVPG GGESPCPRCRREVHRLKMLQEAVLSIQEAQQELHR RHLSTMLSSTVRAGQ

APAPSLLQNPRSWFLLCIFLTCQLFINYILK
Transcript ENSMUST00000121409
Sequence
CAATTTTGCTGAGACCTTGCCCCAGGGGACAGGGACCTTGTTTTCTTCTTTGAGTCCCTCAAGGACTGGCTCTAGCAACTGCTGATTTACTGGGTTCTAG

CAGCCACACCCAGCTTTTTGTTTGAGCTTGGGGCAGACCTAGCAGGCAGGCTGGTCTCCATCTGTGAAGCGGCCCACACTGCACACAGTCCTGCTGGAAG

GGCAGAGCCACCCCTCAGACCTCAAGAAGGCAGTTTCACCATGGCCCTGAGCATCTTGTCTGAGCAGTTCTGCATCCGAAGGCCTCGCCAG - UNI352

36 - AAGCCCCCCAGCACCCACACCATGAAGGAGGAGGCCTTTCTCCGGCGCCGTTTCTCGCTGTGTCCACCAGCTTCTACTCCACAGAAGACTGACCC

CCGGAAAGTCCCACGGAACCTGCTTCTGGGCTGCGAAAATGAGCTTGGTCCCATCACCCCAG - UNI35236 - GAAGGGACATGGAGTCCAACGGCC

CATCACAACCCAGAGATGAAGAGCCCCAGACCCCAGGCTCCGCCACGAAGGTGCCACTG GCTGAGTACAGGCTATGCAATGGATCTGACAAGGAATGTA

CCTCTCCAACGACCAGGGTCTCCAAGAAGGATGCTCTCAAG GCACAGAAGGAGAACTATCGGCAGGAGAAGAAGCGGGCCACGAAGCAGCTGTTCAGTG

CCCTGACTGACCCCAGTGTGGTCATCATGGCTGACAGCCTAAAG ATCCGAGGGACCCTGAAGAGCTGGACGAAGCTGTGGTGTGTACTGAAGCCAGGGG

TGCTGCTCATTTACAAGACACCCAAGGTGGGCCAGTGGGTGGGCACGGTGCTGCTGCACTGCTGCGAGCTTATTGAGCGCCCCTCCAAGAAGGACGGCTT

CTGCTTCAAACTCTTCCACCCGCTGGACCAGTCTGTGTGGGCTGTGAAG GGCCCCAAAGGCGAGAGTGTGGGCTCCATCACTCAGCCCCTCCCTAGCAG

CTACCTGATCTTCAGGGCCGCTTCTGAATCAGACG GCCGCTGCTGGCTAGATGCCCTGGAGCTGGCCCTTCGCTGCTCCAGCCTCCTGCGACTGAGCAC

GTGCAAGCAGGGTCGAGATGGGGAGCAGGGGTCCTCGCCTGATGCCTCTCCCTCTTCTCTCTACGGACTGCCCACCTCGGCCACCATCCCAGATCAAGAC

CTGTTCCC GCTGAATGGGTCTGCCTTGGAGAACGATGCATTCTCAGACAAGTCAGAACGAGAGAATGCAGAAGACTCGGATGCCGAGACCCAGGATCAC

AGCCGCAAGACCAACGAGAGTGGGAGCGACCTGCTAGACAGCCCTGGTGGGCCATGGAGGGGAACTACCTATGTGGAACAGGTCCAGGAGGAGCTGGGAG

AG CTGGACGAGACTTCCCAGGTGGAGACAGTGTCAGAGGAAAACAAGAGCCTGATGTGGGTGCTGCTGCGACAGCTGCGGCCAGGCATGGACCTGTCCC

GTGTGGTGCTGCCGACCTTCGTGTTGGAGCCTCGGTCCTTCCTCGGCAAGCTCTCTGATTACTACTACCACGGAGACCTGCTCTCCAG GGCAGCAGCAG

AGGATGACCCCTACTGCCGCATGAAGCTTGTGCTCCGGTGGTACCTGTCTGGCTTCTATAAGAAGCCCAAG GGCATCAAGAAACCCTATAATCCCATTC

TGGGGGAGACTTTTCGCTGCCGCTGGCTGCACCCTCAGACCAACAGTCACACCTTCTACATAGCAGAACAG GTGTCTCACCATCCTCCTGTGTCTGCCT

TCTATGTCAGCAACAGGAAAGATGGCTTCTGCATGAGTGGCAGCATCACAGCAAAGTCTAAGTTCTATG GGAACTCATTGTCGGCGCTTCTGGACGGCA

AGGCTAAACTCACCTTCCTTAATCGCAAGGAGGAGTATACCCTCACCATGCCCTATGCCCACTGCCGAG GGATCCTCTACGGCACCATGACCATGGAGC

TGGGAGGCAAAGTGAACATCGAGTGTGAGAAGAACAACCTCCAAGCTGAACTGGACTTCAAGCTCAAG CCTTTCTTTGGAAGCAGCGCCAACATCAACC

AGATTTCCGGGAAGATCATGTCAGGAGAGGAAGTCCTGGCACGCCTCACTGGACACTGG GACAGAGATGTATTTATCAAGGAAGAGAGCAGTGGAGGCA

CCGAGCTCTTCTGGACTCCGAGTGAGGAGGTCCGCAGGCAGCGGCTGAAGCGGCACACAGTGCTGTTGGAAGAGCAGAGTGAACTGGAGTCTGAGAG GC

TGTGGCAGCATGTCACCAGGGCCATCCGTGAGGGTGACCAGCACAAAGCCACACAGGAGAAGTCTGTGCTGGAAGAGGCGCAGCGGCAGCGTGCCCGTGA

GCACCAGCAGAGCCTCACTCCATGGAAGCCACAGTTGTTCTTACTGGACCCTCTCACTCAGGAATGGCGCTACCGATATGAGGA CCTCAGCCCCTGGGA

CCCGCTGAAGGACATTGCCCAATATGAGCAAGATGGGATTCTTCATACTCTACAGAGGGAGACTATGTCTGGCCAGACAACCTTTCTGGGGAGTCCTGAC

TCCAGGCACAAG AGGCCTAGCTCTGATCGGCGGCTCCGCAAAGCCAGTGACCAGCCCTCTGGCCATAGCCAGGTCACTGAGAGCAGCGGCTCCACACCT

GAGTCCTGCCCAGACCTCTCTGATGAGGACTTTGTTCCTG GTGGTGAGAGCCCATGTCCTCGGTGCAGGCGAGAGGTACACCGGCTAAAGATGCTACAA

GAGGCCGTGCTGTCCATTCAGGAAGCTCAGCAAGAGCTGCATAG GCACCTTTCGACCATGTTAAGCTCCACAGTGCGTGCTGGGCAGGCGCCAGCCCCC

AGCCTCCTGCAGAATCCCCGCTCCTGGTTCCTGCTCTGCATCTTCCTGACGTGTCAGCTATTCATTAACTATATCCTCAAATAAGAGCCCTTGGAATCAG

CAAGGTGACGCCTGCAGAACTCCCTCCTAGGCACCCAGCACTTTACACCGGCCTGCAGAGGCAGTGGGGCCCACAGGCATGGCCAGTGGGACAGAAGGGT

CCTCGCACAAGAGGATGACAGGTGGGGCCTGGGGCTATGAGGGTGCTGTGACTCCAGCTGTAGGACCCTCCAGGGAGCACTGGCCTCTTCTTTGGAGCCC

TCCACCTAGTACCGGCCTTAACGCTAAAGCCAAATGCAGTTTCTGCCCTGCAGTGTGCCCCTGGTAATCTCAAGTTGCACTCCCAAGCCAGCCCCCACTT

GCCATACGGCATCAGATCTGGGGGTCAGGAGGGCCTGTGCAGGCTTTGGACAGCCACTTACCACAGCACAGGAGAGAGTGAGGTTGCCAGGAGCAGCAGG

AAGGAAGACTCCAGGATTCCCCGGAGCTCTTTGGGTGGTAATGTTGACTTCTGGACAATCTGCCCACCTTGTGCTCACACAAGCATGGACAGGCTGTAGC

TACTCTGGTGAGGACACTGGGACTTTTATCCTGTTGTTAAGCTGTTTCCACAGAAGCCTGTTCAGGTAGTTACTTCACCTACATCTGCCCTACAGCCAGA

GGAGCCCACCTGTGCCACAGGAGTGCCCTGGCCAACTGCAGTGTGAGTTTGTAAGCAAGAGAAGTGCCCAGAGGCTGACCCCAAAGGCCAGGGAGGCCCA

AGCTTGCCACTCTCCCTGACCAATACAGTCTTCCCATTCTGTTGACATTCTGACTACATAGAATTGCAATATCTGAGGCAGCTATGTGCAGTGAGCAGCC

TCTGCATCCAGCCCCTGATCCTATGTGGATGACGCTCTTCGTGTGCGTGTGTGTGTGTGTGCGTGTGTATGTATGTGAGCACCTATGCGTACTCACATTT

GGAGCCTTAATACTTAGTTGGTGCCATCTCCATTGTATCTGATCCTTTCATTTTCCAAGTTTTGTATCCATTTGTCTCTGTCCTTCCCCAATCCTGGGGG

TATGTCTGCTCCATGCCTTGAAATAAATGGAAATACATGTA
Translation
 - UNI35236 - MKEEAFLRRRFSLCPPASTPQKTDPRKVPRNLLLGCENELGPITPG - UNI35236 - GRDMESNGPSQPRDEEPQTPGSATKV

PL AEYRLCNGSDKECTSPTTRVSKKDALK AQKENYRQEKKRATKQLFSALTDPSVVIMADSLK IRGTLKSWTKLWCVLKPGVLLIYKTPKVGQWVGT

VLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVK GPKGESVGSITQPLPSSYLIFRAASESDG GRCWLDALELALRCSSLLRLSTCKQGRDGEQGSSP

DASPSSLYGLPTSATIPDQDLFP PLNGSALENDAFSDKSERENAEDSDAETQDHSRKTNESGSDLLDSPGGPWRGTTYVEQVQEELGE LDETSQVETV

SEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPRSFLGKLSDYYYHGDLLSR RAAAEDDPYCRMKLVLRWYLSGFYKKPK GIKKPYNPILGETFRCRW

LHPQTNSHTFYIAEQ VSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYG GNSLSALLDGKAKLTFLNRKEEYTLTMPYAHCRG GILYGTMTMELGGKV

NIECEKNNLQAELDFKLK PFFGSSANINQISGKIMSGEEVLARLTGHW DRDVFIKEESSGGTELFWTPSEEVRRQRLKRHTVLLEEQSELESER RLW

QHVTRAIREGDQHKATQEKSVLEEAQRQRAREHQQSLTPWKPQLFLLDPLTQEWRYRYED DLSPWDPLKDIAQYEQDGILHTLQRETMSGQTTFLGSPD

SRHK RPSSDRRLRKASDQPSGHSQVTESSGSTPESCPDLSDEDFVPG GGESPCPRCRREVHRLKMLQEAVLSIQEAQQELHR RHLSTMLSSTVRAGQ

APAPSLLQNPRSWFLLCIFLTCQLFINYILK

For any suggestions or comments, please send an email to unitrap@crg.es