Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037608 (Bclaf1)
Chromosomal location
Chr 10: 20032275 - 20062307 (+)
Description
BCL2-associated transcription factor 1 Gene [Source:MGI Symbol;Acc:MGI:1917580]
RefSeq_dna
NM_001025393 NM_001025392 
RefSeq_peptide
NP_001020564.1 NP_722482.1 NP_001020563.1 
UniGene
Mm.404076 Mm.294783 
MGI
MGI:1917580 
Uniprot/SWISSPROT
Q8K019 
Uniprot/SPTREMBL
Q3TSZ0 Q05C67 Q3TEQ0 Q3TRC6 Q3UR37 Q3UDL9 
Human Ortholog
ENSG00000029363 (BCLAF1)
Omim not available
UniTrap UNI374
Vector Insertion
Chr 10: 20032274 - 20032411
Public Clones GC1110 (tigem) RST211 (baygenomics) XG324 (baygenomics) RST161 (baygenomics)
XE222 (baygenomics) XE071 (baygenomics) W066F06 (ggtc) P007C11 (ggtc)
D040F08 (ggtc) W066C08 (ggtc) Q997F12 (ggtc) A061C01 (ggtc) P106C06 (ggtc)
Q020B07 (ggtc) W224E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15623
Vector Insertion
Chr 10: 20032411 - 20037813
Public Clones (sanger) D179G03 (ggtc) P115B05 (ggtc) D040F08 (ggtc) P106C06 (ggtc)
D024D12 (ggtc) PST5848-NR (escells)
Private Clones OST466385 (lexicon) OST464223 (lexicon) OST455900 (lexicon) OST332341 (lexicon)
OST329202 (lexicon) OST329030 (lexicon) OST262117 (lexicon) OST197528 (lexicon)
OST131009 (lexicon) OST32788 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5118
Vector Insertion
Chr 10: 20037918 - 20041808
Public Clones YTC269 (baygenomics) RRH021 (baygenomics) E077C10 (ggtc) PST13416-NR (escells)
PST12495-NR (escells) PST4591-NL (escells) PST4591-NR (escells) PSTVU02.9N (vanderbilt)
Private Clones OST203713 (lexicon) OST174837 (lexicon) OST168035 (lexicon) OST148662 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1097
Vector Insertion
Chr 10: 20042768 - 20043675
Public Clones CE0060 (sanger) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37906
Vector Insertion
Chr 10: 20043675 - 20044945
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10820
Vector Insertion
Chr 10: 20048014 - 20049115
Public Clones P114E07 (ggtc)
Private Clones OST214681 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8002
Vector Insertion
Chr 10: 20049201 - 20051891
Public Clones RRI468 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1044
Vector Insertion
Chr 10: 20053379 - 20054304
Public Clones AY0327 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23494
Vector Insertion
Chr 10: 20059514 - 20059728
Public Clones not available
Private Clones OST257174 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100045
Sequence
GGAAGTGACGGAGCCGAGCTAGCGCGACGAGGCCGCCTCTATGGTCTTCCTCTCCTTCTGGAGTCGGGAAATGGCCGCTGTGTAGTTAGCACGGAGGTAA

ACCCTGCACGCACATCGTGCTTCGGCGTGTCAG - UNI374 - - UNI15623 - GTATTTGAATTTAGAGTTTAGTTTCCCATAACATTTTCTACA

AGAAGAATCTTGGTAGTGTCTCAAAGACATCACTGACTTCTGGATCCTGCAGAAAGCCCAAG - UNI5118 - GTGAAAAGAAATGGGCCGCTCCAAT

TCTAGATCACATTCTTCAAGATCCAAGTCTAGATCACAGTCTAGTTCTAGATCAAGATCAAGATCACATTCTAGAAAGAAGAGATACAG - UNI1097 

- GTCTCGTTCCAGAACATATTCGAGGTCTCGTAGTAGAGATCGTATTTATTCTAGAGATTATCGTCGAGATTACAGGAATAATAGAGGAATGAGACGAC

CTTATGGGTACAGAGGAAGGGGTAGAGGGTATTATCAAGGAGGAGGAGGGAGATACCATCGAGGTGGCTATAGACCTGTCTGGAATAGAAGGCACTCTAG

GAGTCCTAGACGAGGTCGGTCACGGTCCAGGAGTCCAAAAAGAAGATCCGTGTCTTCTCAAAGATCCCGAAGCAGATCTCGCCGGTCATATAGATCCTCT

AGGTCTCCAAGATCATCATCATCTCGCTCTTCATCCCCATATAGCAAATCTCCTGTCTCTAAAAGACGAGGGTCTCAGGAAAAACAAACCAAAAAAGCTG

AGGGGGAACCCCAAGAAGAGAGTCCTTTGAAAAGCAAATCACAGGAGGAACCAAAGGATACTTTTGAACATGATCCATCTGAATCTATTGATGAGTTTAA

TAAATCTGCTACTTCTGGTGATATTTGGCCTGGCCTTTCAGCTTATGATAATAGTCCAAGGTCACCTCATAGTCCTTCACCTATTGCTACACCACCCAGT

CAGAGTTCATCATGCTCAGATGCCCCCATGCTTAGTACAGTGCACTCTGCCAAAAATACCCCTTCTCAGCATTCACATTCCATTCAGCACAGTCCTGAGA

GGTCTGGATCTGGCTCTGTTGGAAATGGGTCGAGTCGATATAGTCCTTCTCAGAATAGTCCGATTCATCACATCCCATCACGAAGAAGCCCTGCCAAGAC

AATCACACCACAGAATGCTCCAAGAGAGGAATCTAGGGGGCGGTCCTCCTTTTATCCTGAAGGAGATCAGGAAACAGCAAAGACAGGAAAGTTTTTAAAA

AG - UNI1097 - GTTCACAGATGAAGAGTCTAGAGTATTCCTGCTTGATAGGGGTAATATCAGGGATAAAGAGGCTCCGAAGGAGAAAGGGTCAGAG

AAAGGCAGGGCAGATGGAGATTGGGATGACCAGGAAGTTCTAGATTACTTTAGTGATAAAGAGTCTGCAAAACAAAAATTCCATGACTCTGAAGGGGATG

ACACAGAGGAGACAGAGGATTATAGACAGTTTAGGAAATCAGTCCTAGCAGATCAGGGCAAGAGCTTTGCTACTTCATCTCACCGGAATACTGAGGAGGA

AGGACCCAAGTACAAGTCCAAAGTTTCATTAAAAGGCAATAGAGAAAGTGATGGATTTAGAGAAGAAAAAAATTATAAACTGAAAGAGACTGCATACATA

GTCGAAAGGCCTAGCACTGCAAAGGACAAGCACAAGGAAGAAGACAAAGGCTCTGATAGAATAACAGTGAAGAAAGAAGTGCAGTCACCGGAGCAGGTAA

AGTCTGAAAAGCTCAAAGAGCTCTTTGATTACAGTCCCCCTCTACACAAGAGTCTGGATGCACGAGAAAAGTCCATCTTCAGAGAGGAGAGCCCACTGAG

GATCAAAATGATAGCCAGTGATTCTCACCGTCCTGAAGTCAAACTCAAAATGGCACCTGTTCCTCTTGACGATTCCAACAG ACCTGCCTCCTTGACTAA

AGACAGGCTACTTGCTAGCACGCTTGTCCATTCTGTCAAGAAAGAGCAAGAATTCCGATCCATCTTTGACCACATTAAGCTGCCTCAGGCCAACAAAAGC

ACTTCAGAATCATTTATACAACACATTGTATCCTTGGTTCATCATGTGAAAG AACAATACTTCAAATCACCTGCAGTGACCCTAAACGAGCGGTTCACT

TCATACCAGAAAGCTACTGAAGAACATAGTACCCGGCAAAAGAGCCCCGAGATACACAG - UNI10820 - GAGGATTGACATCTCTCCCAGCGCTCT

GAGGAAGCACACCCGGCTAGCAGGAGAGGAGAGAGGTTTTAAAGAAGAAATTCAGAAG - UNI8002 - GGAGATAAAAAGTTAAGGTGTGATTCGGC

TGACCTTCGGCACGACATTGACCGTCGCCGTAAAGAGAGAAGTAAAGAGCGGGGAGATTCCAAGGGCTCCAGGGAGTCCAGTGGGTCCAGAAAGCAAGAA

AAAACACCAAAGGATTACAAGGAGTATAAACCTTACAAAGATGACAG CAAAAATGTATTTGTCTTTTACACGGCTTATGGTGGATGAGGACAAAAACTT

TGGAATAGCAAGCTAACACTGAAAAAAAAATGACAAATTAATGTGTCCTATTATCCAGGCTACATCAGGAGGTTGGACTTCAATGCAGTGCATTTCTAGA

AACAGTTTGT CAAACATAAAGGTAGAGAGCGGGACCATTCCCGGTCATCGTCCTCGTCAGCATCGCCGTCCTCGCCCAGTTCTCGAGAAGAAAAAGAGA

GTAAGAAAGAGAGAGAAGAAGAATTTAAAACTCACCACGAGATGAAAGACTACTCAGGATTTGCAGGAGTTAGCAGACCACGAGGAACCTTT - UNI10

44 - - UNI23494 - CACGATGACAGAGATGATGGTGTGGATTACTGGGCCAAAAGAGGAAGAGGTCGTGGTACTTTTCAACGTGGCAGAGGGCGCT

TTAATTTCAAAAAATCAGGTAGCAGTCCAAAATGGACTCATGACAAATACCAAGGAGATGGGATTGTTGAAGATGACGAAGAGACCATGGAAAATAATGA

AGAGAAGAAGGACAGACGCAAAGAAGAAAAG - UNI23494 - GAATAGTCTCAAGATTGCAACAGGGAGCAGAACTTGACACTTACATTTTTTTAAA

CCTGATTTTTGTTTTCAAATAAGAATGTAAGCATTTTACTTAAACTGTACTGTTTGCAAGTAGTTTATAGAAATTTTGTTTTAAGTCTTCAAATACCTTG

AAAAAAAATAGACTGTATGTTGAAAATTGTATTGAAATAAAGTAGAAAATGTTCGGTATC
Translation
 - UNI374 - - UNI15623 -  - UNI5118 - MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYR - UNI1097 - RSRSRTYSRSRSRD

RIYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPY

SKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTV

HSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTITPQNAPREESRGRSSFYPEGDQETAKTGKFLKR - UNI1097 - 

RFTDEESRVFLLDRGNIRDKEAPKEKGSEKGRADGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQGKSFATSSHRNTEEEGPKY

KSKVSLKGNRESDGFREEKNYKLKETAYIVERPSTAKDKHKEEDKGSDRITVKKEVQSPEQVKSEKLKELFDYSPPLHKSLDAREKSIFREESPLRIKMI

ASDSHRPEVKLKMAPVPLDDSNR RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQANKSTSESFIQHIVSLVHHVKE EQYFKSPAVTLNERFTS

YQKATEEHSTRQKSPEIHR - UNI10820 - RRIDISPSALRKHTRLAGEERGFKEEIQK - UNI8002 - GDKKLRCDSADLRHDIDRRRKERSK

ERGDSKGSRESSGSRKQEKTPKDYKEYKPYKDDS SKNVFVFYTAYGG  - UNI1044 - - UNI23494 -  - UNI23494 - 
Transcript ENSMUST00000092678
Sequence
GTCGGAAGTGACGGAGCCGAGCTAGCGCGACGAGGCCGCCTCTATGGTCTTCCTCTCCTTCTGGAGTCGGGAAATGGCCGCTGTGTAGTTAGCACGGAGG

TAAACCCTGCACGCACATCGTGCTTCGGCGTGTCAG - UNI374 - - UNI15623 - GTATTTGAATTTAGAGTTTAGTTTCCCATAACATTTTCT

ACAAGAAGAATCTTGGTAGTGTCTCAAAGACATCACTGACTTCTGGATCCTGCAGAAAGCCCAAG - UNI5118 - GTGAAAAGAAATGGGCCGCTCC

AATTCTAGATCACATTCTTCAAGATCCAAGTCTAGATCACAGTCTAGTTCTAGATCAAGATCAAGATCACATTCTAGAAAGAAGAGATACAG - UNI10

97 - TTCTAGGTCTCGTTCCAGAACATATTCGAGGTCTCGTAGTAGAGATCGTATTTATTCTAGAGATTATCGTCGAGATTACAGGAATAATAGAGGAA

TGAGACGACCTTATGGGTACAGAGGAAGGGGTAGAGGGTATTATCAAGGAGGAGGAGGGAGATACCATCGAGGTGGCTATAGACCTGTCTGGAATAGAAG

GCACTCTAGGAGTCCTAGACGAGGTCGGTCACGGTCCAGGAGTCCAAAAAGAAGATCCGTGTCTTCTCAAAGATCCCGAAGCAGATCTCGCCGGTCATAT

AGATCCTCTAGGTCTCCAAGATCATCATCATCTCGCTCTTCATCCCCATATAGCAAATCTCCTGTCTCTAAAAGACGAGGGTCTCAGGAAAAACAAACCA

AAAAAGCTGAGGGGGAACCCCAAGAAGAGAGTCCTTTGAAAAGCAAATCACAGGAGGAACCAAAGGATACTTTTGAACATGATCCATCTGAATCTATTGA

TGAGTTTAATAAATCTGCTACTTCTGGTGATATTTGGCCTGGCCTTTCAGCTTATGATAATAGTCCAAGGTCACCTCATAGTCCTTCACCTATTGCTACA

CCACCCAGTCAGAGTTCATCATGCTCAGATGCCCCCATGCTTAGTACAGTGCACTCTGCCAAAAATACCCCTTCTCAGCATTCACATTCCATTCAGCACA

GTCCTGAGAGGTCTGGATCTGGCTCTGTTGGAAATGGGTCGAGTCGATATAGTCCTTCTCAGAATAGTCCGATTCATCACATCCCATCACGAAGAAGCCC

TGCCAAGACAATCACACCACAGAATGCTCCAAGAGAGGAATCTAGGGGGCGGTCCTCCTTTTATCCTGAAGGAGATCAGGAAACAGCAAAGACAGGAAAG

TTTTTAAAAAG - UNI1097 - GTTCACAGATGAAGAGTCTAGAGTATTCCTGCTTGATAGGGGTAATATCAGGGATAAAGAGGCTCCGAAGGAGAAA

GGGTCAGAGAAAGGCAGGGCAGATGGAGATTGGGATGACCAGGAAGTTCTAGATTACTTTAGTGATAAAGAGTCTGCAAAACAAAAATTCCATGACTCTG

AAGGGGATGACACAGAGGAGACAGAGGATTATAGACAGTTTAGGAAATCAGTCCTAGCAGATCAGGGCAAGAGCTTTGCTACTTCATCTCACCGGAATAC

TGAGGAGGAAGGACCCAAGTACAAGTCCAAAGTTTCATTAAAAGGCAATAGAGAAAGTGATGGATTTAGAGAAGAAAAAAATTATAAACTGAAAGAGACT

GCATACATAGTCGAAAGGCCTAGCACTGCAAAGGACAAGCACAAGGAAGAAGACAAAGGCTCTGATAGAATAACAGTGAAGAAAGAAGTGCAGTCACCGG

AGCAGGTAAAGTCTGAAAAGCTCAAAGAGCTCTTTGATTACAGTCCCCCTCTACACAAGAGTCTGGATGCACGAGAAAAGTCCATCTTCAGAGAGGAGAG

CCCACTGAGGATCAAAATGATAGCCAGTGATTCTCACCGTCCTGAAGTCAAACTCAAAATGGCACCTGTTCCTCTTGACGATTCCAACAG ACCTGCCTC

CTTGACTAAAGACAGGCTACTTGCTAGCACGCTTGTCCATTCTGTCAAGAAAGAGCAAGAATTCCGATCCATCTTTGACCACATTAAGCTGCCTCAGGCC

AACAAAAGCACTTCAGAATCATTTATACAACACATTGTATCCTTGGTTCATCATGTGAAAG AACAATACTTCAAATCACCTGCAGTGACCCTAAACGAG

CGGTTCACTTCATACCAGAAAGCTACTGAAGAACATAGTACCCGGCAAAAGAGCCCCGAGATACACAG - UNI10820 - GAGGATTGACATCTCTCC

CAGCGCTCTGAGGAAGCACACCCGGCTAGCAGGAGAGGAGAGAGGTTTTAAAGAAGAAATTCAGAAG - UNI8002 - GGAGATAAAAAGTTAAGGTG

TGATTCGGCTGACCTTCGGCACGACATTGACCGTCGCCGTAAAGAGAGAAGTAAAGAGCGGGGAGATTCCAAGGGCTCCAGGGAGTCCAGTGGGTCCAGA

AAGCAAGAAAAAACACCAAAGGATTACAAGGAGTATAAACCTTACAAAGATGACAG CAAACATAAAGGTAGAGAGCGGGACCATTCCCGGTCATCGTCC

TCGTCAGCATCGCCGTCCTCGCCCAGTTCTCGAGAAGAAAAAGAGAGTAAGAAAGAGAGAGAAGAAGAATTTAAAACTCACCACGAGATGAAAGACTACT

CAGGATTTGCAGGAGTTAGCAGACCACGAGGAACCTTT - UNI1044 - - UNI23494 - CACGATGACAGAGATGATGGTGTGGATTACTGGGCC

AAAAGAGGAAGAGGTCGTGGTACTTTTCAACGTGGCAGAGGGCGCTTTAATTTCAAAAAATCAGGTAGCAGTCCAAAATGGACTCATGACAAATACCAAG

GAGATGGGATTGTTGAAGATGACGAAGAGACCATGGAAAATAATGAAGAGAAGAAGGACAGACGCAAAGAAGAAAAG - UNI23494 - GAATAGTCT

CAAGATTGCAACAGGGAGCAGAACTTGACACTTACATTTTTTTAAACCTGATTTTTGTTTTCAAATAAGAATGTAAGCATTTTACTTAAACTGTACTGTT

TGCAAGTAGTTTATAGAAATTTTGTTTTAAGTCTTCAAATACCTTGAAAAAAAATAGACTGTATGTTGAAAATTGTATTGAAATAAAGTAGAAAATGTTC

GGTATCATATTTGTAACTATCAACTTTTAAAAACATTTGACTGTTTTTGTTACATGCATTGTATTTCTGCTTTGTCTATAAGAAGTGGTCAAGTCCAACT

CTGTGACAACTCTTAACTTGCCTCCCTGTTAATAAGTCTTTGATTCTGAAGTGAACGTTAGCTTTTCTCAAACCCACACAAATCCTTGAACAGGAATTGT

TTATAGTGACCACACTAATTATTTTAACTGTACACATCAGTTTAACATCTTTTAAAATTTGAACACTACGTAGTAGGGTGACTAATTTTTGAAGAATATC

ACAAAGTTGCTATTATGGTAAACTAGTTTCACACTTCAGCAAACATAAGGAGGACAGCTTTGTTAATAGCTAAAAAGTACAAATTAAAAGATTTGAGAAA

GTGGTATTTTTTTCTGAAAGCAAACAATGGCTTGTAAAGTCATTTGAAGAGACTTTCCAATATGAATTCAAAATTCCACTCTTATCTGATAGTTTGAGTC

ATGGTCTTAGATACCAGCTACCTACGAGAGAGAGAGAAATTGGTTTGTAATATCAGTGTAAGTAAAATCCTGATTCCATAAACCTGGTTGTATTTAAAAC

AAAAAACAAAACTACAATGAAACTTGGGAGTCCTTTTCATGTAGAGGAAGGTTATCCTGTAGCATAATGTATGCACACGGTCATCTAGTACCTGATTGGA

TAGCTTACATATTTATTGGATGCTTTGAACAGCTGTATATTAGTCCATAACATAACTACAAGATTAGATAGAGGCAACATACTGTTAAGTCATATTTAAG

TAATTAGTTTTCTCTTAATGTTGCCAATAGAAGGCTTGAGCAGGAAGCTTGTAGCACTGATCTAATTGTGTGTACAACCATCAACTTAAATTTATAAAAT

GGCCTTTTTCTTGGCGTCTATTCTTTAGGTAAATATGTTTCTTTTTCTTTTTCTTTTTTTTTTTTTTTGCTATTTGTTTAATAGCTTTTAAAGGAATAAA

GCAAACCAGTGCTAAGAATTTTTTTTTTAAAGCTAGCTACATTGCAGCAGAGTTGTTGTGTATGTGTGCATTTAAAGAAGATAATGCTTATTCTGTTAAT

GCACACTTTTAAGTTTTGATGATTTTTTACAGTGTTTTAGACCTTGAATAGCTAGTGGCTTTTGCTAAAAACTTTTGGCAACAAAATTAAACTAAAACCA

AAGTCAACATGTGAAGTGTTTATCATAAGATCCTCAGGAGTCAGTATTGCATGATGCTCCCCTTAATTGTCACACTGAAATTATGTAGTAAATCAGAAAA

TACCTGAAAAGCAACTTTATTGCTTCAATCTGGATATAAGTAGTTATTTATAAATAGTTAAGATTAATTTAAATGTAAAAACGTGCTTAATTCCCTAATA

ATTTTCATACCATTCCTATTTTATATGAATATCCACCTTCATTTCAACAGTTCCTTGGTTACACACTCAATCTTTACGTTTGTACTGCTTACCTTTACTT

TCTCCACAACAGAGACAAGCAGATTGGTTGAACCTTATTTAATGAGGAGTAACAGGCTGTTTTTAAGTGTTTGCCTGTGGCTACTTCCGTTCTATAGCTC

AAGAATATGCCATTACATCATAGTCAAGGGGTTGCTATGAGAACTGTAGTAGAGAATACCACTGTGAGTCTTCTCCTTTTCAGAGCCAAACACAAAGCAG

CCTGCGTGCATTCTTTGAGGTGAGCATTTAATCACACACTTGATGACATTACAAAGCTAAACCATGCCTCTTGGTAAAGCTGCTTGATTACAAGTGCCAG

GAAAACGACTGTTATCCACTGCGTACTACATGTTACATGCTGCATACTGTATGTTACACACTGCATACTATGTGTTATACACTGCATACACATACTTCCT

TTACCCAGAGAAAAGAAATAAAATTGAACCAAAGGATTTTCCCAGAAAAAAACAAGAAAGCAGTTTTAGAAGGCCATGACTCAATTCTTAGGTTTGTATG

CTTAAACATCTTAGGAATTTTAATATAAAAAGAAAAGGCTTTCCCATTTGCACTCTATTTCAAAGAATTGTTATTGTTCCCTTTCGTTAAAATCAGTGTT

GGGAATTAAATTATAATTTGAGGGGAAAATATCCAATGGGAATGAATGTAGATGGCTAAAGGACTCTTCCTCAGTGTGGTGTATATTTCAACAGGGACCC

TTGTAAATTGTCATATGCCAATAAAATGTCCTAAGTGGTAA
Translation
 - UNI374 - - UNI15623 -  - UNI5118 - MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYS - UNI1097 - SSRSRSRTYSRSRS

RDRIYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSS

PYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLS

TVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTITPQNAPREESRGRSSFYPEGDQETAKTGKFLKR - UNI1097 

- RFTDEESRVFLLDRGNIRDKEAPKEKGSEKGRADGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQGKSFATSSHRNTEEEGP

KYKSKVSLKGNRESDGFREEKNYKLKETAYIVERPSTAKDKHKEEDKGSDRITVKKEVQSPEQVKSEKLKELFDYSPPLHKSLDAREKSIFREESPLRIK

MIASDSHRPEVKLKMAPVPLDDSNR RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQANKSTSESFIQHIVSLVHHVKE EQYFKSPAVTLNERF

TSYQKATEEHSTRQKSPEIHR - UNI10820 - RRIDISPSALRKHTRLAGEERGFKEEIQK - UNI8002 - GDKKLRCDSADLRHDIDRRRKER

SKERGDSKGSRESSGSRKQEKTPKDYKEYKPYKDDS SKHKGRERDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKDYSGFAGVSRPRGTF -

 UNI1044 - - UNI23494 - HDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDDEETMENNEEKKDRRKEEK - UN

I23494 - E
Transcript ENSMUST00000043881
Sequence
GTCGGAAGTGACGGAGCCGAGCTAGCGCGACGAGGCCGCCTCTATGGTCTTCCTCTCCTTCTGGAGTCGGGAAATGGCCGCTGTGTAGTTAGCACGGAGG

TAAACCCTGCACGCACATCGTGCTTCGGCGTGTCAG - UNI374 - - UNI15623 - GTATTTGAATTTAGAGTTTAGTTTCCCATAACATTTTCT

ACAAGAAGAATCTTGGTAGTGTCTCAAAGACATCACTGACTTCTGGATCCTGCAGAAAGCCCAAG - UNI5118 - GTGAAAAGAAATGGGCCGCTCC

AATTCTAGATCACATTCTTCAAGATCCAAGTCTAGATCACAGTCTAGTTCTAGATCAAGATCAAGATCACATTCTAGAAAGAAGAGATACAG - UNI10

97 - TTCTAGGTCTCGTTCCAGAACATATTCGAGGTCTCGTAGTAGAGATCGTATTTATTCTAGAGATTATCGTCGAGATTACAGGAATAATAGAGGAA

TGAGACGACCTTATGGGTACAGAGGAAGGGGTAGAGGGTATTATCAAGGAGGAGGAGGGAGATACCATCGAGGTGGCTATAGACCTGTCTGGAATAGAAG

GCACTCTAGGAGTCCTAGACGAGGTCGGTCACGGTCCAGGAGTCCAAAAAGAAGATCCGTGTCTTCTCAAAGATCCCGAAGCAGATCTCGCCGGTCATAT

AGATCCTCTAGGTCTCCAAGATCATCATCATCTCGCTCTTCATCCCCATATAGCAAATCTCCTGTCTCTAAAAGACGAGGGTCTCAGGAAAAACAAACCA

AAAAAGCTGAGGGGGAACCCCAAGAAGAGAGTCCTTTGAAAAGCAAATCACAGGAGGAACCAAAGGATACTTTTGAACATGATCCATCTGAATCTATTGA

TGAGTTTAATAAATCTGCTACTTCTGGTGATATTTGGCCTGGCCTTTCAGCTTATGATAATAGTCCAAGGTCACCTCATAGTCCTTCACCTATTGCTACA

CCACCCAGTCAGAGTTCATCATGCTCAGATGCCCCCATGCTTAGTACAGTGCACTCTGCCAAAAATACCCCTTCTCAGCATTCACATTCCATTCAGCACA

GTCCTGAGAGGTCTGGATCTGGCTCTGTTGGAAATGGGTCGAGTCGATATAGTCCTTCTCAGAATAGTCCGATTCATCACATCCCATCACGAAGAAGCCC

TGCCAAGACAATCACACCACAGAATGCTCCAAGAGAGGAATCTAGGGGGCGGTCCTCCTTTTATCCTGAAGGAGATCAGGAAACAGCAAAGACAGGAAAG

TTTTTAAAAAG - UNI1097 - GTTCACAGATGAAGAGTCTAGAGTATTCCTGCTTGATAGGGGTAATATCAGGGATAAAGAGGCTCCGAAGGAGAAA

GGGTCAGAGAAAGGCAGGGCAGATGGAGATTGGGATGACCAGGAAGTTCTAGATTACTTTAGTGATAAAGAGTCTGCAAAACAAAAATTCCATGACTCTG

AAGGGGATGACACAGAGGAGACAGAGGATTATAGACAGTTTAGGAAATCAGTCCTAGCAGATCAGGGCAAGAGCTTTGCTACTTCATCTCACCGGAATAC

TGAGGAGGAAGGACCCAAGTACAAGTCCAAAGTTTCATTAAAAGGCAATAGAGAAAGTGATGGATTTAGAGAAGAAAAAAATTATAAACTGAAAGAGACT

GCATACATAGTCGAAAGGCCTAGCACTGCAAAGGACAAGCACAAGGAAGAAGACAAAGGCTCTGATAGAATAACAGTGAAGAAAGAAGTGCAGTCACCGG

AGCAGGTAAAGTCTGAAAAGCTCAAAGAGCTCTTTGATTACAGTCCCCCTCTACACAAGAGTCTGGATGCACGAGAAAAGTCCATCTTCAGAGAGGAGAG

CCCACTGAGGATCAAAATGATAGCCAGTGATTCTCACCGTCCTGAAGTCAAACTCAAAATGGCACCTGTTCCTCTTGACGATTCCAACAG ACCTGCCTC

CTTGACTAAAGACAGGCTACTTGCTAGCACGCTTGTCCATTCTGTCAAGAAAGAGCAAGAATTCCGATCCATCTTTGACCACATTAAGCTGCCTCAGGCC

AACAAAAGCACTTCAGAATCATTTATACAACACATTGTATCCTTGGTTCATCATGTGAAAG AACAATACTTCAAATCACCTGCAGTGACCCTAAACGAG

CGGTTCACTTCATACCAGAAAGCTACTGAAGAACATAGTACCCGGCAAAAGAGCCCCGAGATACACAG - UNI10820 - GAGGATTGACATCTCTCC

CAGCGCTCTGAGGAAGCACACCCGGCTAGCAGGAGAGGAGAGAGGTTTTAAAGAAGAAATTCAGAAG - UNI8002 - GGAGATAAAAAGTTAAGGTG

TGATTCGGCTGACCTTCGGCACGACATTGACCGTCGCCGTAAAGAGAGAAGTAAAGAGCGGGGAGATTCCAAGGGCTCCAGGGAGTCCAGTGGGTCCAGA

AAGCAAGAAAAAACACCAAAGGATTACAAGGAGTATAAACCTTACAAAGATGACAG CAAACATAAAGGTAGAGAGCGGGACCATTCCCGGTCATCGTCC

TCGTCAGCATCGCCGTCCTCGCCCAGTTCTCGAGAAGAAAAAGAGAGTAAGAAAGAGAGAGAAGAAGAATTTAAAACTCACCACGAGATGAAAGACTACT

CAGGATTTGCAGGAGTTAGCAGACCACGAGGAACCTTT - UNI1044 - TTTCGAATTAGAGGCAGAGGAAGAGCCAGAGGAGTTTTTGCTGGGACAA

ATACTGGTCCAAACAACTCAAATACCACTTTTCAAAAGAGACCGAAGGAAGAGGAATGGGATCCAGAATATACCCCAAAGAGCAAGAAGTACTTCTTG -

 UNI23494 - CACGATGACAGAGATGATGGTGTGGATTACTGGGCCAAAAGAGGAAGAGGTCGTGGTACTTTTCAACGTGGCAGAGGGCGCTTTAATT

TCAAAAAATCAGGTAGCAGTCCAAAATGGACTCATGACAAATACCAAGGAGATGGGATTGTTGAAGATGACGAAGAGACCATGGAAAATAATGAAGAGAA

GAAGGACAGACGCAAAGAAGAAAAG - UNI23494 - GAATAGTCTCAAGATTGCAACAGGGAGCAGAACTTGACACTTACATTTTTTTAAACCTGAT

TTTTGTTTTCAAATAAGAATGTAAGCATTTTACTTAAACTGTACTGTTTGCAAGTAGTTTATAGAAATTTTGTTTTAAGTCTTCAAATACCTTGAAAAAA

AATAGACTGTATGTTGAAAATTGTATTGAAATAAAGTAGAAAATGTTCGGTATCATATTTGTAACTATCAACTTTTAAAAACATTTGACTGTTTTTGTTA

CATGCATTGTATTTCTGCTTTGTCTATAAGAAGTGGTCAAGTCCAACTCTGTGACAACTCTTAACTTGCCTCCCTGTTAATAAGTCTTTGATTCTGAAGT

GAACGTTAGCTTTTCTCAAACCCACACAAATCCTTGAACAGGAATTGTTTATAGTGACCACACTAATTATTTTAACTGTACACATCAGTTTAACATCTTT

TAAAATTTGAACACTACGTAGTAGGGTGACTAATTTTTGAAGAATATCACAAAGTTGCTATTATGGTAAACTAGTTTCACACTTCAGCAAACATAAGGAG

GACAGCTTTGTTAATAGCTAAAAAGTACAAATTAAAAGATTTGAGAAAGTGGTATTTTTTTCTGAAAGCAAACAATGGCTTGTAAAGTCATTTGAAGAGA

CTTTCCAATATGAATTCAAAATTCCACTCTTATCTGATAGTTTGAGTCATGGTCTTAGATACCAGCTACCTACGAGAGAGAGAGAAATTGGTTTGTAATA

TCAGTGTAAGTAAAATCCTGATTCCATAAACCTGGTTGTATTTAAAACAAAAAACAAAACTACAATGAAACTTGGGAGTCCTTTTCATGTAGAGGAAGGT

TATCCTGTAGCATAATGTATGCACACGGTCATCTAGTACCTGATTGGATAGCTTACATATTTATTGGATGCTTTGAACAGCTGTATATTAGTCCATAACA

TAACTACAAGATTAGATAGAGGCAACATACTGTTAAGTCATATTTAAGTAATTAGTTTTCTCTTAATGTTGCCAATAGAAGGCTTGAGCAGGAAGCTTGT

AGCACTGATCTAATTGTGTGTACAACCATCAACTTAAATTTATAAAATGGCCTTTTTCTTGGCGTCTATTCTTTAGGTAAATATGTTTCTTTTTCTTTTT

CTTTTTTTTTTTTTTTGCTATTTGTTTAATAGCTTTTAAAGGAATAAAGCAAACCAGTGCTAAGAATTTTTTTTTTAAAGCTAGCTACATTGCAGCAGAG

TTGTTGTGTATGTGTGCATTTAAAGAAGATAATGCTTATTCTGTTAATGCACACTTTTAAGTTTTGATGATTTTTTACAGTGTTTTAGACCTTGAATAGC

TAGTGGCTTTTGCTAAAAACTTTTGGCAACAAAATTAAACTAAAACCAAAGTCAACATGTGAAGTGTTTATCATAAGATCCTCAGGAGTCAGTATTGCAT

GATGCTCCCCTTAATTGTCACACTGAAATTATGTAGTAAATCAGAAAATACCTGAAAAGCAACTTTATTGCTTCAATCTGGATATAAGTAGTTATTTATA

AATAGTTAAGATTAATTTAAATGTAAAAACGTGCTTAATTCCCTAATAATTTTCATACCATTCCTATTTTATATGAATATCCACCTTCATTTCAACAGTT

CCTTGGTTACACACTCAATCTTTACGTTTGTACTGCTTACCTTTACTTTCTCCACAACAGAGACAAGCAGATTGGTTGAACCTTATTTAATGAGGAGTAA

CAGGCTGTTTTTAAGTGTTTGCCTGTGGCTACTTCCGTTCTATAGCTCAAGAATATGCCATTACATCATAGTCAAGGGGTTGCTATGAGAACTGTAGTAG

AGAATACCACTGTGAGTCTTCTCCTTTTCAGAGCCAAACACAAAGCAGCCTGCGTGCATTCTTTGAGGTGAGCATTTAATCACACACTTGATGACATTAC

AAAGCTAAACCATGCCTCTTGGTAAAGCTGCTTGATTACAAGTGCCAGGAAAACGACTGTTATCCACTGCGTACTACATGTTACATGCTGCATACTGTAT

GTTACACACTGCATACTATGTGTTATACACTGCATACACATACTTCCTTTACCCAGAGAAAAGAAATAAAATTGAACCAAAGGATTTTCCCAGAAAAAAA

CAAGAAAGCAGTTTTAGAAGGCCATGACTCAATTCTTAGGTTTGTATGCTTAAACATCTTAGGAATTTTAATATAAAAAGAAAAGGCTTTCCCATTTGCA

CTCTATTTCAAAGAATTGTTATTGTTCCCTTTCGTTAAAATCAGTGTTGGGAATTAAATTATAATTTGAGGGGAAAATATCCAATGGGAATGAATGTAGA

TGGCTAAAGGACTCTTCCTCAGTGTGGTGTATATTTCAACAGGGACCCTTGTAAATTGTCATATGCCAATAAAATGTCCTAAGTGGTAA
Translation
 - UNI374 - - UNI15623 -  - UNI5118 - MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYS - UNI1097 - SSRSRSRTYSRSRS

RDRIYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSS

PYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLS

TVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTITPQNAPREESRGRSSFYPEGDQETAKTGKFLKR - UNI1097 

- RFTDEESRVFLLDRGNIRDKEAPKEKGSEKGRADGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQGKSFATSSHRNTEEEGP

KYKSKVSLKGNRESDGFREEKNYKLKETAYIVERPSTAKDKHKEEDKGSDRITVKKEVQSPEQVKSEKLKELFDYSPPLHKSLDAREKSIFREESPLRIK

MIASDSHRPEVKLKMAPVPLDDSNR RPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQANKSTSESFIQHIVSLVHHVKE EQYFKSPAVTLNERF

TSYQKATEEHSTRQKSPEIHR - UNI10820 - RRIDISPSALRKHTRLAGEERGFKEEIQK - UNI8002 - GDKKLRCDSADLRHDIDRRRKER

SKERGDSKGSRESSGSRKQEKTPKDYKEYKPYKDDS SKHKGRERDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKDYSGFAGVSRPRGTF -

 UNI1044 - FRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFL - UNI23494 - HDDRDDGVDYWAKRGRGRGTFQRGRG

RFNFKKSGSSPKWTHDKYQGDGIVEDDEETMENNEEKKDRRKEEK - UNI23494 - E

For any suggestions or comments, please send an email to unitrap@crg.es