Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037610 (Kcnmb2)
Chromosomal location
Chr 3: 31801429 - 32099102 (+)
Description
potassium large conductance calcium-activated channel, subfamily M, beta member 2 Gene [Source:MGI (curated);Acc:Kcnmb2-001]
RefSeq_dna
NM_028231 
RefSeq_peptide
NP_082507.1 
UniGene
Mm.64790 
MGI
MGI:1919663 
Uniprot/SWISSPROT
Q9CZM9 
Uniprot/SPTREMBL
B5BNW1 
Human Ortholog
ENSG00000197584 (KCNMB2)
Omim not available
UniTrap UNI33109
Vector Insertion
Chr 3: 31807438 - 31988164
Public Clones IST11711F8 (tigm) IST13646C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30550
Vector Insertion
Chr 3: 32010778 - 32054968
Public Clones IST12130C3HMR1 (tigm) IST12184E4 (tigm) IST12184E4BBR1 (tigm) IST12187C7HMR1 (tigm)
IST12130E9HMR1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119970
Sequence
CTGTCTAGCGTGCCTGTCACTCCTATTGTCCTTCCAAACTCTTGCAGACATTTTGAGCGAGGAGTAAAGCTATGAGTTAGCGAGGGTGTGACATCAATGG

TCCACAAAGACAGCCAGCAGGAAAGGTAAAGATGAGGACCGGTGGCTGTGTGGAGGACTACACGGGATCACTGTCATTAAAAATTAAGCGTGGCTTTTGA

GGAAGATGTGACAACTCCTGAAG GCCAAAAGTACACTCCGGTGTCTGGAAGGAAACTTCAGTGGTGCAGCGTGCAGACTCCAATAAGATGAAGCACTGG

AAAAGAGCATCACTCTGTGAACAC - UNI30550 - - UNI33109 - GTCTTTCTGCCACTTCCCCAGGACTTCCACAGTGAGGAAAGGAGCTGCA

GGACCAACATCCTCTAAGATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTACAGACAGGACGAGAAAAG AAATATCTACCAGAAAATCAGGGAC

CATGACCTCCTGGACAAAAGGAAAACTGTGACAGCTCTGAAGGCTGGGGAGGACCGGGCCATCCTGCTCGGCCTGGCCATGATGGTGTGCTCCATCATGA

TGTACTTCCTGCTGGGAATCACACTGCTGCGCTCCTACATGCAGAG CGTGTGGACAGAAGAAGCCCAGTGTGCCCTGCTGAATGTGTCAATCACAGAAA

CGTTTAACTGTTCCTTCAGCTGTGGGCCCGACTGTTGGAAGCTCTCTCAGTACCCTTGCCTGCAGGTGTACGTGAACCTGACATCTTCCGGGGAGAGGCT

CCTCCTCTACCACACGGAAGAGACCATGAAGATCAATCAAAAG TGCTCCTATATTCCTAAGTGTGGAAACAACTTTGAGGAGTCCATGTCTCTCGTGAG

TGTCGTCATGGAAAACTTCAGGAGACACCAACACTTCCCCTGCTATTCTGACCCAGAAGGAAACCAGAAGAGTGTCATCCTGACCAAACTCTACAGCTCC

AATGTGCTGTTCCATTCTCTCTTCTGGCCAACTTGTATGATGGCTGGGGGTGTGGCAATCGTTGCTATGGTGAAACTAACTCAGTACCTCTCCCTGCTTT

GTGAGAGGATCCAACGGATCAACAGATAAAAGAAAAAAATCATGGATAAGATATTTTTCTTTAAAGCTCAAATACTGTTTTATTTCGTTCTTCACCAAAG

AACCTTAAGTTTGTAATGTGCAGTCTGTTATGGGTTCCTTAATTATTCTATGTAGAGCAATAATGCAAACGCTGTCCTATATGCAAACATGATGTCCTTA

TTATTCAGGAGAATTAACTGTTCCTCATTGGTTGGTTGTTTCATTATATTGTTTTGATGCTGGAACTAGTCTGTCGTCTTTCCACCAGAATAGGGCTCAG

CTACTCATTGCTAAGTGTTGTGGGGCATAGGGGCATGGAGGCACTATCCCCAAGACCAGGTCTCTGTTCTGAGTTTCCAGACTTCCTGAAGACAAGATTT

TTCTTCATTTGTTGTTTACTGAAGCTACAGCCAAAAACACATTTTTTTTCTTATCCTATATTGAGCCCTGTAGCAAGTGAAGGAGTTGTTTCCTGACTAA

AGGGTATTAAACTTATTATTATTATTATTATTATTTTTACCACAGCACTGTAAGGAAGGGGGGGAAACCTAGCCAGCAACTTTTCTTTCATCACTTTTCA

TTCACAACTTCAGATTTTTGAAAATAATTATCAACTCTCTAATGTCTTCCGATCAGAGTCCCTTTTCCATCTATGACCCTGCTACTGTGTGGGAGACAAA

GCTGGTGAGATCACTCCCAGTAAACTGACTGGGTGTTGGTAGGCATGCCATTGCAATTTTGGAAAGTCTATGTTACAAAGATATTTATGGGAAATCTTAA

TTCCATTTCCACTGGACTATTAGAATCAAATATTAATATACTAAGGACTGGTGAATTGGTTGCAGTGGGTGAGTCTGTCAGGGCCAGCTATCATGTCAGA

ATATTACTCTTTGAGAATTTATGTTTCAGTAAACGAATGTATGTAGGGTCTCTCTTTCTGAAAAAAAAAAAAAACTGTTGCCTGTTGGGGTTTTAAATCT

ATGTGTGCAGAATCTTTGTCTCCTCTACATATTTTATTTTTCTACTCACTGTTCCCTTTTGGTTGTTATATTTTATATGCAGAATAGACCTTTTTCCTAA

CACATGTTTGAAATGAATAACAGGTTTGAGGGAAGCCTTTCTTCACATTGATGTTTACTCATTCTATTTGGTGGGGGGAGGGGAAAGGGGGTTGGTTTTA

AATAAAGACATTCTGTCTTTTATTTAATATTGATATCTAAGGGAGAAGACAAACATCTATCTTTCTCATCTATATTTAAGTACCCTTTTGTAACATAGTA

TCGATGTTTTTTAGGTAATTGCAAAATTTTACAAATCATTTGTGGAATGAACGGTGAAACTTATCTGAGGAAGCAGAATATTGTAATTCATAGTGTGACT

TTTCATAAGCAAATAAATCCCTAGGGTGTAATCAGGACTTCAAATGTGTAATTAAATTTTTTAAACCCATTTGATGGCAAGATTTTAATACTTCTTGCAT

TCAGATAAACCCATGACTATCCAAACAATTCTAATTTGTATTCAAAGGTATTTTAAGAGACTGTAAAGAAAATCCCTTTTTCTGACACTTAAACAATACA

TGTTATGTTGTAAACATTTGGAAAACACCACAGAAAATCATTTATTTTTATTCCATCTTTAAAATGTATTTGTCAAGATAGAAGAAAATCCTTTGGAACT

ATAGGGTTGAAATTTGCAATCTTAAATGTTCCCTGGGATTCCCATCAACTGATGCAAGGATGAAGCATACATGATGACATTATGACATACTTTATTTTTA

ACTTCTTTAAGATTTTTCATTAAAAGTTCCTAGCTAAGACCTGGAGCCAA
Translation
  - UNI30550 - - UNI33109 - MFIWTSGRTSSSYRQDEKR RNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLL

RSYMQS SVWTEEAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQK CSYIPKCGNNFEESMSLVSVVMENFR

RHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Transcript ENSMUST00000119310
Sequence
AGTATGAAAATTCGAAAGCAGTGGGGAAGAAATGCTGGACCTATCACAGCGATGCTAACAGACAGCCTATTACAGTATTTAATAAAAACAGAAGCAGCGT

GCCTGTCATAGGCTAATAAATCCTACCTCCTGCACGCTTTTAAAAACAGTCTGGACCGGCTTCCACAGAGCTTCGGAGAACTAATCTTAAGCATGGCTGT

CTAGCGTGCCTGTCACTCCTATTGTCCTTCCAAACTCTTGCAGACATTTTGAGCGAGGAGTAAAGCTATGAGTTAGCGAGGGTGTGACATCAATGGTCCA

CAAAGACAGCCAGCAGGAAAGGTAAAGATGAGGACCGGTGGCTGTGTGGAGGACTACACGGGATCACTGTCATTAAAAATTAAGCGTGGCTTTTGAGGAA

GATGTGACAACTCCTGAAG - UNI30550 - - UNI33109 - GTCTTTCTGCCACTTCCCCAGGACTTCCACAGTGAGGAAAGGAGCTGCAGGACC

AACATCCTCTAAGATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTACAGACAGGACGAGAAAAG AAATATCTACCAGAAAATCAGGGACCATGA

CCTCCTGGACAAAAGGAAAACTGTGACAGCTCTGAAGGCTGGGGAGGACCGGGCCATCCTGCTCGGCCTGGCCATGATGGTGTGCTCCATCATGATGTAC

TTCCTGCTGGGAATCACACTGCTGCGCTCCTACATGCAGAG CGTGTGGACAGAAGAAGCCCAGTGTGCCCTGCTGAATGTGTCAATCACAGAAACGTTT

AACTGTTCCTTCAGCTGTGGGCCCGACTGTTGGAAGCTCTCTCAGTACCCTTGCCTGCAGGTGTACGTGAACCTGACATCTTCCGGGGAGAGGCTCCTCC

TCTACCACACGGAAGAGACCATGAAGATCAATCAAAAG TGCTCCTATATTCCTAAGTGTGGAAACAACTTTGAGGAGTCCATGTCTCTCGTGAGTGTCG

TCATGGAAAACTTCAGGAGACACCAACACTTCCCCTGCTATTCTGACCCAGAAGGAAACCAGAAGAGTGTCATCCTGACCAAACTCTACAGCTCCAATGT

GCTGTTCCATTCTCTCTTCTGGCCAACTTGTATGATGGCTGGGGGTGTGGCAATCGTTGCTATGGTGAAACTAACTCAGTACCTCTCCCTGCTTTGTGAG

AGGATCCAACGGATCAACAGATAAAAGAAAAAAATCATGGATAAGATATTTTTCTTTAAAGCTCAAATACTGTTTTATTTCGTTCTTCACCAAAGAACCT

TAAGTTTGTAATGTGCAGTCTGTTATGGGTTCCTTAATTATTCTATGTAGAGCAATAATGCAAACGCTGTCCTATATGCAAACATGATGTCCTTATTATT

CAGGAGAATTAACTGTTCCTCATTGGTTGGTTGTTTCATTATATTGTTTTGATGCTGGAACTAGTCTGTCGTCTTTCCACCAGAATAGGGCTCAGCTACT

CATTGCTAAGTGTTGTGGGGCATAGGGGCATGGAGGCACTATCCCCAAGACCAGGTCTCTGTTCTGAGTTTCCAGACTTCCTGAAGACAAGATTTTTCTT

CATTTGTTGTTTACTGAAGCTACAGCCAAAAACACATTTTTTTTCTTATCCTATATTGAGCCCTGTAGCAAGTGAAGGAGTTGTTTCCTGACTAAAGGGT

ATTAAACTTATTATTATTATTATTATTATTTTTACCACAGCACTGTAAGGAAGGGGGGGAAACCTAGCCAGCAACTTTTCTTTCATCACTTTTCATTCAC

AACTTCAGATTTTTGAAAATAATTATCAACTCTCTAATGTCTTCCGATCAGAGTCCCTTTTCCATCTATGACCCTGCTACTGTGTGGGAGACAAAGCTGG

TGAGATCACTCCCAGTAAACTGACTGGGTGTTGGTAGGCATGCCATTGCAATTTTGGAAAGTCTATGTTACAAAGATATTTATGGGAAATCTTAATTCCA

TTTCCACTGGACTATTAGAATCAAATATTAATATACTAAGGACTGGTGAATTGGTTGCAGTGGGTGAGTCTGTCAGGGCCAGCTATCATGTCAGAATATT

ACTCTTTGAGAATTTATGTTTCAGTAAACGAATGTATGTAGGGTCTCTCTTTCTGAAAAAAAAAAAAAACTGTTGCCTGTTGGGGTTTTAAATCTATGTG

TGCAGAATCTTTGTCTCCTCTACATATTTTATTTTTCTACTCACTGTTCCCTTTTGGTTGTTATATTTTATATGCAGAATAGACCTTTTTCCTAACACAT

GTTTGAAATGAATAACAGGTTTGAGGGAAGCCTTTCTTCACATTGATGTTTACTCATTCTATTTGGTGGGGGGAGGGGAAAGGGGGTTGGTTTTAAATAA

AGACATTCTGTCTTTTATTTAATATTGATATCTAAGGGAGAAGACAAACATCTATCTTTCTCATCTATATTTAAGTACCCTTTTGTAACATAGTATCGAT

GTTTTTTAGGTAATTGCAAAATTTTACAAATCATTTGTGGAATGAACGGTGAAACTTATCTGAGGAAGCAGAATATTGTAATTCATAGTGTGACTTTTCA

TAAGCAAATAAATCCCTAGGGTGTAATCAG
Translation
 - UNI30550 - - UNI33109 - MFIWTSGRTSSSYRQDEKR RNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLR

SYMQS SVWTEEAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQK CSYIPKCGNNFEESMSLVSVVMENFRR

HQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Transcript ENSMUST00000045917
Sequence
AGATGTGACAACTC - UNI30550 - CTGCAGGTCTTTCTGCCACTTCCCCAGGACTTCCACAGTGAGGAAAGGAGCTGCAGGACCAACATCCTCTAA

GATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTACAGACAGGACGAGAAAAG AAATATCTACCAGAAAATCAGGGACCATGACCTCCTGGACAA

AAGGAAAACTGTGACAGCTCTGAAGGCTGGGGAGGACCGGGCCATCCTGCTCGGCCTGGCCATGATGGTGTGCTCCATCATGATGTACTTCCTGCTGGGA

ATCACACTGCTGCGCTCCTACATGCAGAG CGTGTGGACAGAAGAAGCCCAGTGTGCCCTGCTGAATGTGTCAATCACAGAAACGTTTAACTGTTCCTTC

AGCTGTGGGCCCGACTGTTGGAAGCTCTCTCAGTACCCTTGCCTGCAGGTGTACGTGAACCTGACATCTTCCGGGGAGAGGCTCCTCCTCTACCACACGG

AAGAGACCATGAAGATCAATCAAAAG TGCTCCTATATTCCTAAGTGTGGAAACAACTTTGAGGAGTCCATGTCTCTCGTGAGTGTCGTCATGGAAAACT

TCAGGAGACACCAACACTTCCCCTGCTATTCTGACCCAGAAGGAAACCAGAAGAGTGTCATCCTGACCAAACTCTACAGCTCCAATGTGCTGTTCCATTC

TCTCTTCTGGCCAACTTGTATGATGGCTGGGGGTGTGGCAATCGTTGCTATGGTGAAACTAACTCAGTACCTCTCCCTGCTTTGTGAGAGGATCCAACGG

ATCAACAGATAAAAGAAAAAAATCATGGATAAGATATTTTTCTTTAAAGCTCAAATACTGTTTTATTTCGTTCTTCACCAAAGAACCTTAAGTTTGTAAT

GTGCAGTCTGTTATGGGTTCCTTAATTATTCTATGTAGAGCAATAATGCAAACGCTGTCCTATATGCAAACATGATGTCCTTATTATTCAGGAGAATTAA

CTGTTCCTCATTGGTTGGTTGTTTCATTATATTGTTTTGATGCTGGAACTAGTCTGTCGTCTTTCCACCAGAATAGGGCTCAGCTACTCATTGCTAAGTG

TTGTGGGGCATAGGGGCATGGAGGCACTATCCCCAAGACCAGGTCTCTGTTCTGAGTTTCCAGACTTCCTGAAGACAAGATTTTTCTTCATTTGTTGTTT

ACTGAAGCTACAGCCAAAAACACATTTTTTTTCTTATCCTATATTGAGCCCTGTAGCAAGTGAAGGAGTTGTTTCCTGACTAAAGGGTATTAAACTTATT

ATTATTATTATTATTATTTTTACCACAGCACTGTAAGGAAGGGGGGGAAACCTAGCCAGCAACTTTTCTTTCATCACTTTTCATTCACAACTTCAGATTT

TTGAAAATAATTATCAACTCTCTAATGTCTTCCGATCAGAGTCCCTTTTCCATCTATGACCCTGCTACTGTGTGGGAGACAAAGCTGGTGAGATCACTCC

CAGTAAACTGACTGGGTGTTGGTAGGCATGCCATTGCAATTTTGGAAAGTCTATGTTACAAAGATATTTATGGGAAATCTTAATTCCATTTCCACTGGAC

TATTAGAATCAAATATTAATATACTAAGGACTGGTGAATTGGTTGCAGTGGGTGAGTCTGTCAGGGCCAGCTATCATGTCAGAATATTACTCTTTGAGAA

TTTATGTTTCAGTAAACGAATGTATGTAGGGTCTCTCTTTCTGAAAAAAAAAAAAAACTGTTGCCTGTTGGGGTTTTAAATCTATGTGTGCAGAATCTTT

GTCTCCTCTACATATTTTATTTTTCTACTCACTGTTCCCTTTTGGTTGTTATATTTTATATGCAGAATAGACCTTTTTCCTAACACATGTTTGAAATGAA

TAACAGGTTTGAGGGAAGCCTTTCTTCACATTGATGTTTACTCATTCTATTTGGTGGGGGGAGGGGAAAGGGGGTTGGTTTTAAATAAAGACATTCTGTC

TTTTATTTAATATTGATATCTAAGGGAGAAGACAAACATCTATCTTTCTCATCTATATTTAAGTACCCTTTTGTAACATAGTATCGATGTTTTTTAGGTA

ATTGCAAAATTTTACAAATCATTTGTGGAATGAACGGTGAAACTTATCTGAGGAAGCAGAATATTGTAATTCATAGTGTGACTTTTCATAAGCAAATAAA

TCCCTAGGGTGTAATCAG
Translation
 - UNI30550 - MFIWTSGRTSSSYRQDEKR RNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLLRSYMQS SVWTEEA

QCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQK CSYIPKCGNNFEESMSLVSVVMENFRRHQHFPCYSDPEGN

QKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Transcript ENSMUST00000108244
Sequence
CTGTCTAGCGTGCCTGTCACTCCTATTGTCCTTCCAAACTCTTGCAGACATTTTGAGCGAGGAGTAAAGCTATGAGTTAGCGAGGGTGTGACATCAATGG

TCCACAAAGACAGCCAGCAGGAAAGGTAAAGATGAGGACCGGTGGCTGTGTGGAGGACTACACGGGATCACTGTCATTAAAAATTAAGCGTGGCTTTTGA

GGAAGATGTGACAACTCCTGAAG GCCAAAAGTACACTCCGGTGTCTGGAAGGAAACTTCAGTGGTGCAGCGTGCAGACTCCAATAAGATGAAGCACTGG

AAAAGAGCATCACTCTGTGAACACGTAA - UNI33109 - TTCTGCCAC - UNI30550 - TTCCCCAGGACTTCCACAGTGAGGAAAGGAGCTGC

AGGACCAACATCCTCTAAGATGTTTATATGGACCAGTGGCCGGACCTCTTCATCTTACAGACAGGACGAGAAAAG AAATATCTACCAGAAAATCAGGGA

CCATGACCTCCTGGACAAAAGGAAAACTGTGACAGCTCTGAAGGCTGGGGAGGACCGGGCCATCCTGCTCGGCCTGGCCATGATGGTGTGCTCCATCATG

ATGTACTTCCTGCTGGGAATCACACTGCTGCGCTCCTACATGCAGAG CGTGTGGACAGAAGAAGCCCAGTGTGCCCTGCTGAATGTGTCAATCACAGAA

ACGTTTAACTGTTCCTTCAGCTGTGGGCCCGACTGTTGGAAGCTCTCTCAGTACCCTTGCCTGCAGGTGTACGTGAACCTGACATCTTCCGGGGAGAGGC

TCCTCCTCTACCACACGGAAGAGACCATGAAGATCAATCAAAAG TGCTCCTATATTCCTAAGTGTGGAAACAACTTTGAGGAGTCCATGTCTCTCGTGA

GTGTCGTCATGGAAAACTTCAGGAGACACCAACACTTCCCCTGCTATTCTGACCCAGAAGGAAACCAGAAGAGTGTCATCCTGACCAAACTCTACAGCTC

CAATGTGCTGTTCCATTCTCTCTTCTGGCCAACTTGTATGATGGCTGGGGGTGTGGCAATCGTTGCTATGGTGAAACTAACTCAGTACCTCTCCCTGCTT

TGTGAGAGGATCCAACGGATCAACAGATAAAAGAAAAAAATCATGGATAAGATATTTTTCTTTAAAGCTCAAATACTGTTTTATTTCGTTCTTCACCAAA

GAACCTTAAGTTTGTAATGTGCAGTCTGTTATGGGTTCCTTAATTATTCTATGTAGAGCAATAATGCAAACGCTGTCCTATATGCAAACATGATGTCCTT

ATTATTCAGGAGAATTAACTGTTCCTCATTGGTTGGTTGTTTCATTATATTGTTTTGATGCTGGAACTAGTCTGTCGTCTTTCCACCAGAATAGGGCTCA

GCTACTCATTGCTAAGTGTTGTGGGGCATAGGGGCATGGAGGCACTATCCCCAAGACCAGGTCTCTGTTCTGAGTTTCCAGACTTCCTGAAGACAAGATT

TTTCTTCATTTGTTGTTTACTGAAGCTACAGCCAAAAACACATTTTTTTTCTTATCCTATATTGAGCCCTGTAGCAAGTGAAGGAGTTGTTTCCTGACTA

AAGGGTATTAAACTTATTATTATTATTATTATTATTTTTACCACAGCACTGTAAGGAAGGGGGGGAAACCTAGCCAGCAACTTTTCTTTCATCACTTTTC

ATTCACAACTTCAGATTTTTGAAAATAATTATCAACTCTCTAATGTCTTCCGATCAGAGTCCCTTTTCCATCTATGACCCTGCTACTGTGTGGGAGACAA

AGCTGGTGAGATCACTCCCAGTAAACTGACTGGGTGTTGGTAGGCATGCCATTGCAATTTTGGAAAGTCTATGTTACAAAGATATTTATGGGAAATCTTA

ATTCCATTTCCACTGGACTATTAGAATCAAATATTAATATACTAAGGACTGGTGAATTGGTTGCAGTGGGTGAGTCTGTCAGGGCCAGCTATCATGTCAG

AATATTACTCTTTGAGAATTTATGTTTCAGTAAACGAATGTATGTAGGGTCTCTCTTTCTGAAAAAAAAAAAAAACTGTTGCCTGTTGGGGTTTTAAATC

TATGTGTGCAGAATCTTTGTCTCCTCTACATATTTTATTTTTCTACTCACTGTTCCCTTTTGGTTGTTATATTTTATATGCAGAATAGACCTTTTTCCTA

ACACATGTTTGAAATGAATAACAGGTTTGAGGGAAGCCTTTCTTCACATTGATGTTTACTCATTCTATTTGGTGGGGGGAGGGGAAAGGGGGTTGGTTTT

AAATAAAGACATTCTGTCTTTTATTTAATATTGATATCTAAGGGAGAAGACAAACATCTATCTTTCTCATCTATATTTAAGTACCCTTTTGTAACATAGT

ATCGATGTTTTTTAGGTAATTGCAAAATTTTACAAATCATTTGTGGAATGAACGGTGAAACTTATCTGAGGAAGCAGAATATTGTAATTCATAGTGTGAC

TTTTCATAAGCAAATAAATCCCTAGGGTGTAATCAGGACTTCAAATGTGTAATTAAATTTTTTAAACCCATTTGATGGCAAGATTTTAATACTTCTTGCA

TTCAGATAAACCCATGACTATCCAAACAATTCTAATTTGTATTCAAAGGTATTTTAAGAGACTGTAAAGAAAATCCCTTTTTCTGACACTTAAACAATAC

ATGTTATGTTGTAAACATTTGGAAAACACCACAGAAAATCATTTATTTTTATTCCATCTTTAAAATGTATTTGTCAAGATAGAAGAAAATCCTTTGGAAC

TATAGGGTTGAAATTTGCAATCTTAAATGTTCCCTGGGATTCCCATCAACTGATGCAAGGATGAAGCATACATGATGACATTATGACATACTTTATTTTT

AACTTCTTTAAGATTTTTCATTAAAAGTTCCTAGCTAAGACCTGGAGCC
Translation
  - UNI33109 -  - UNI30550 - MFIWTSGRTSSSYRQDEKR RNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITL

LRSYMQS SVWTEEAQCALLNVSITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGERLLLYHTEETMKINQK CSYIPKCGNNFEESMSLVSVVMENF

RRHQHFPCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR

For any suggestions or comments, please send an email to unitrap@crg.es