Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037625 (Cldn11)
Chromosomal location
Chr 3: 31048868 - 31063240 (+)
Description
claudin 11 Gene [Source:MGI (curated);Acc:Cldn11-001]
RefSeq_dna
NM_008770 
RefSeq_peptide
NP_032796.1 
UniGene
Mm.4425 
MGI
MGI:106925 
Uniprot/SWISSPROT
Q60771 
Human Ortholog
ENSG00000013297 (CLDN11)
Omim not available
UniTrap UNI31777
Vector Insertion
Chr 3: 31053001 - 31061997
Public Clones IST11648B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046174
Sequence
AGCGCTGCAGTCCCCTCCAGGCGCACCTGTCCCCGCTGCACGCTGTCGCAGCAGTGCTTGCAGCCGCTCTCTCCCCATCTCGAGTAGCCCGGAGCCAGCG

GCTCGCGAGGGCCAAGAGGGCAAGCCTAGGGAAGGCTCTGTCCAGGACGACACAGGGGGCACAATCCGTGTGAGTCGAGCTGCGTGGACGTCGCTGCGGC

CACCATGGTAGCCACTTGCCTTCAGGTGGTGGGTTTCGTCACGAGCTTCGTGGGTTGGATTGGCATCATCGTCACAACGTCCACCAATGACTGGGTGGTG

ACCTGCAGCTACACCATCCCCACCTGCCGAAAAATGGACGAACTGGGCTCCAAGGGCCTGTGGGCTGACTGCGTCATGGCCACTGGTCTCTACCACTGCA

AACCCCTGGTGGACATCCTCATCCTTCCAG GCTACGTGCAGGCTTGTAGAGCCCTCATGATTGCTGCCTCCGTTCTGGGCCTGCCCGCCATCTTGCTGC

TGTTGACAGTTCTCCCCTGCATCCGAATGGGCCACGAGCCTGGAGTGGCCAAGTACAGGCGAGCCCAGCTGGCTGGGGTGCTCCTTATTCTGCTGG - U

NI31777 - CTCTCTGCGCCATTGTCGCCACCATCTGGTTTCCTGTATGTGCCCACCGCGAGATCACCATCGTGAGCTTTGGCTACTCGCTGTACGCAG

GTTGGATCGGTGCTGTGATGTGCCTGGTGGGTGGCTGTGTCATCGTCTGCTGCTCCGGGGATGCACAGTCATTTGGAGAAAACCGTTTCTATTACTCTTC

TGGTTCCAGCTCGCCAACGCATGCCAAGAGTGCCCATGTCTAAGAGGGCTGCTCCACTGCCCGCCGAGGTGCTGTAAATGCTGGGCCTGGGCCCTGGGTT

TGCTCGCCACAGTGGGGAGAAGCCCACTTCCCTGCCAGGCACTAAAGCCAAAGTTCTAGAAAGTATCCTGCCCCGGCATTTTGAAGTCGTAACACCCCAC

CCACCCACCCACCACTTCTTGGCTGCCTTAAAAGAAAGCTCTAGCTCAGTTAATGCCCACATAGTTTTCTCCTGGAGTTGCGGGCTGTGGCTGTTTGCTC

TTTCCTCGGGCATTCCATTGTTGTTGATTAAAAAAATATTTTGTTTCTCTCTTAAATTCAAATGTCTTGGGAACATTGCTGACTTGGGTGTGGATTGGGA

AAGAAATAAAAGATGCTTTTCAAAGGGTTACCAACGACAGTGGAAGCCTTATAGAGACAGCTCTCTTCTCCCTTTCGGCTTAGTTTCAAGGTCACTTATA

TATAAGAGATAGAAATGGATAGATTGGGAACACGGGTGGGAGGGGAACTCAGAGCTTTCCCTCCACGGGAAGCTTCTCTTTTATAAGTTGAGGGGTTGGG

TGTCTTTTTTTTTTTAGTTTGCGATTTTACATTTTTCTGTACGTACTTTTTCAAGATTGATCATTTTTATAACCACGGGTTTCCTGAAAATTCTCAATTC

ACCAATATGAAGGAAATGAACCAAGCAGACGTTAATATGCAATAAATAATAGTACGAAGATTATAACTTTAACTGACTGCCCACGGTTTCCAGGTTTGTA

TGCTATAGTTTTTAATCCTATGGTTGCATATGCTTCAAATTAACACATTTAAAAATCTTTTCTCCCCTTCTATTTCTGTCTCCATTCTGTTAGAGACCAT

GAAGCAGTATTGTTTAACATAAGTTGTACTGTTAAGTTTGGCTTCATGGGTGTAAACACCAATGGTCTGTCAGTGTCTAAGACTCTGGATACTGCAAGCT

CCGTCCGGTGCATTTGTTCAGGTAAAATCTGTGCAATAAAATAACAAACTGTC
Translation
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVDILILPG GYVQACRALMIAASVLGLPAILL

LLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLA - UNI31777 - ALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQ

SFGENRFYYSSGSSSPTHAKSAHV

For any suggestions or comments, please send an email to unitrap@crg.es