Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037636 (Slc25a43)
Chromosomal location
Chr X: 34283706 - 34317197 (+)
Description
solute carrier family 25, member 43 Gene [Source:MGI (curated);Acc:Slc25a43-001]
RefSeq_dna
NM_001085497 
RefSeq_peptide
NP_001078966.1 
MGI
MGI:2684854 
Uniprot/SWISSPROT
A2A3V2 
Uniprot/SPTREMBL
B2RWC0 
Human Ortholog
ENSG00000077713 (SLC25A43)
Omim not available
UniTrap UNI36310
Vector Insertion
Chr X: 34284014 - 34292127
Public Clones IST12044G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13451
Vector Insertion
Chr X: 34297936 - 34315476
Public Clones CMHD-GT_312D04-3 (cmhd) IST10211C7 (tigm) IST14891D10 (tigm) IST11400E12 (tigm)
IST10153G10 (tigm) IST12278B2HMF1 (tigm) IST13288E1 (tigm) IST10362G5 (tigm)
IST12021H6 (tigm) IST14459G2 (tigm) IST13187H8 (tigm) IST12278B2BBF1 (tigm)
IST10458A6 (tigm) IST11627A10 (tigm)
Private Clones OST470875 (lexicon) OST459196 (lexicon) OST407735 (lexicon) OST398519 (lexicon)
OST381398 (lexicon) OST354033 (lexicon) OST346155 (lexicon) OST338331 (lexicon)
OST290870 (lexicon) OST285916 (lexicon) OST283699 (lexicon) OST276700 (lexicon)
OST207658 (lexicon) OST176741 (lexicon) OST170873 (lexicon) OST153974 (lexicon)
OST150303 (lexicon) OST120882 (lexicon) OST120864 (lexicon) OST120846 (lexicon)
OST120828 (lexicon) OST120824 (lexicon) OST116080 (lexicon) OST106820 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25430
Vector Insertion
Chr X: 34315612 - 34316996
Public Clones IST14891D10 (tigm) IST10415A3 (tigm)
Private Clones OST184162 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047655
Sequence
GCCACGAGGTGGCCGGCACGGGCCTGGGTCAGGATGGCTACGTGGAGACGGGATGGCCGGTTAACCGGCAGCCAGCGGCTCCTGTGTGCGGGGCTGGCCG

GGGCGTTCAGCCTCAGCCTCACCGCGCCCCTGGAGCTTGCCACTGTGCTGGCCCAAGTCGGCAAGGTGCAAAGCCACTCCCTGGGGCTGTGGGCCACCGG

ACGCCGGGTGTGGCTGTCCGAGGGGCCAAGGGCCCTGTGGAAAGGGAATGGCGTGGCCTGCCTGCGCCTCTTCCCCTGCAGCATGGTACAGCTGGCCGCC

TACCGAAA - UNI36310 - GTTCGTTGTGCTATTCATGGATGACCTGGGCCGTATTTCCCAGTGGAGTTCCATTGTGACTGGAAGTCTCGCAGGCAT

GGTTTCCACGATTGTCACATACCCTACAGACCTCATCAAAACCCGATTGATGGTGCAGAACGTGCTGGAACCATCATACAGGGGGCTAATCCATGCTTTT

TCTACTATTTATCAACAAGAAGGGTTCCTGGCCCTTTATCGAGGGGTATCCCTCACTGTTTTAG GTGCTGTTCCCTTCTCTGCTGGCTCCCTTCTAGTT

TACATGAACCTGGAAAAAGTCTGGAATGGACCCCGGGACCGCTTTTCTCACCTGCAGAACTTTGCCAATGTCTGTGTGGCTGCTGCTGTGAGCCAGACCC

TCTCCTTTCCCTTTGACACTGTGAAGAGAAAGATGCAG - UNI13451 - GCTCAAAGTCCTTATCTTCCCCACTATGGAGGAGTAGATGTCCACTTC

TCAGGAGCAGCTGACTGCTTCCGGCAGATCGTGAAAACCCAAGGGGTACTGGGGCTCTGGAACGGACTGACGGCTAACTTACTAAAG - UNI25430 -

 GTAGTTCCATATTTTGGAGTTATGTTTAGCATGTTTGAGTTCTGTAAGAGAATTTTTCTTTATCAAAATGGTTACACCCTGTCCCCACTGACCTATAAA

CTGACCCCAGGAGTGGACCAAAGTTTGAAGCCCCAGGAATTACGGGAGCTAAAGAAGTTCTTCAAACGCAGAAAACTGCACTCCAAAACACCACCTTGGT

AA
Translation
MATWRRDGRLTGSQRLLCAGLAGAFSLSLTAPLELATVLAQVGKVQSHSLGLWATGRRVWLSEGPRALWKGNGVACLRLFPCSMVQLAAYRK - UNI36

310 - KFVVLFMDDLGRISQWSSIVTGSLAGMVSTIVTYPTDLIKTRLMVQNVLEPSYRGLIHAFSTIYQQEGFLALYRGVSLTVLG GAVPFSAGSLL

VYMNLEKVWNGPRDRFSHLQNFANVCVAAAVSQTLSFPFDTVKRKMQ - UNI13451 - AQSPYLPHYGGVDVHFSGAADCFRQIVKTQGVLGLWNGL

TANLLK - UNI25430 - VVPYFGVMFSMFEFCKRIFLYQNGYTLSPLTYKLTPGVDQSLKPQELRELKKFFKRRKLHSKTPPW

For any suggestions or comments, please send an email to unitrap@crg.es