Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037640 (Zfp60)
Chromosomal location
Chr 7: 28516408 - 28538721 (+)
Description
zinc finger protein 60 Gene [Source:MGI (curated);Acc:Zfp60-001]
RefSeq_dna
NM_009560 NM_029531 
RefSeq_peptide
NP_083807.2 NP_033586.2 
UniGene
Mm.348021 Mm.406425 Mm.66913 
MGI
MGI:99207 
Uniprot/SWISSPROT
P16374 
Uniprot/SPTREMBL
Q8CEA3 Q8K0D9 
Human Ortholog
not available
Omim not available
UniTrap UNI10719
Vector Insertion
Chr 7: 28516684 - 28521954
Public Clones (sanger) 5SD136D09 (ggtc) P033F06 (ggtc) 3SE286B08 (ggtc) E001E08 (ggtc)
3SE028B03 (ggtc) 3SD136D09 (ggtc) P108F08 (ggtc) 5SE285D04 (ggtc)
D103D11 (ggtc) 3SH002F06 (ggtc) H002F06 (ggtc) 3SD088B04 (ggtc) E033E08 (ggtc)
3SE285D04 (ggtc) IST10024C10 (tigm) IST14666G9 (tigm) IST14591A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15802
Vector Insertion
Chr 7: 28521954 - 28522008
Public Clones not available
Private Clones OST472802 (lexicon) OST466507 (lexicon) OST427006 (lexicon) OST414861 (lexicon)
OST412760 (lexicon) OST348132 (lexicon) OST321042 (lexicon) OST312153 (lexicon)
OST308504 (lexicon) OST282941 (lexicon) OST270087 (lexicon) OST262633 (lexicon)
OST260481 (lexicon) OST258391 (lexicon) OST243854 (lexicon) OST236483 (lexicon)
OST231751 (lexicon) OST220542 (lexicon) OST202458 (lexicon) OST166970 (lexicon)
OST156284 (lexicon) OST143217 (lexicon) OST137849 (lexicon) OST134966 (lexicon)
OST110953 (lexicon) OST102796 (lexicon) OST55209 (lexicon) OST43487 (lexicon)
OST37520 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18002
Vector Insertion
Chr 7: 28522008 - 28523321
Public Clones (sanger) 5SD026F06 (ggtc) 3SD026F06 (ggtc) IST14535F3 (tigm)
Private Clones OST432330 (lexicon) OST405500 (lexicon) OST393400 (lexicon) OST328141 (lexicon)
OST304961 (lexicon) OST277578 (lexicon) OST247431 (lexicon) OST224284 (lexicon)
OST216369 (lexicon) OST216273 (lexicon) OST207961 (lexicon) OST197098 (lexicon)
OST186704 (lexicon) OST184677 (lexicon) OST179987 (lexicon) OST66043 (lexicon)
OST60570 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1498
Vector Insertion
Chr 7: 28523449 - 28525975
Public Clones CC0806 (sanger)
Private Clones OST230098 (lexicon) OST87057 (lexicon) OST40639 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6799
Vector Insertion
Chr 7: 28526075 - 28533186
Public Clones RHA043 (baygenomics) IST10750D4 (tigm) IST14703B10 (tigm) IST10854E6 (tigm)
Private Clones OST426710 (lexicon) OST359946 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36543
Vector Insertion
Chr 7: 28533186 - 28536709
Public Clones IST10074A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108336
Sequence
GGTGCCCTGGCGGCGCTATAGCGGACGGTCGGGTCTTTCTGGTCTGAGTAGGGAATTGCTTTGTGTCTTCGGTCTCTGCAGA - UNI10719 - - UN

I15802 - GGGAGGAAGCCTGAAGAAGAATGGCCAACTCTAGTTCTCAACACATGGTCTGT - UNI15802 - - UNI18002 - GGGTCAGTGAC

ATTTAGGGATGTGGCTGTTGACTTCTCTCAGGAGGAGTGGGCCTGCCTGGATGCTACTCAGAAGGTCTTATACAGGAACATAATGTTGGAGACCTACAGC

AACCTGGTCGCAGTGG - UNI1498 - TGGGACGTTGCATTCCCAAGCCAGATCTGATCGTCTTACTAGAGCAGGAGAAAGAGCCCTGGATGGCTGTG

AAGAAAGAAACAGGCAGGCCGAGCCAAG - UNI6799 - - UNI36543 - GTTTGGAGACAGGTTTTGAAGCTGAAAATAGATCTCCAAAGAATCA

TGTTTATAATAAAAAGTTACCCAAACAAACCATACAGCAATTAAGTAAAACTTCGGACGTCCAGGGCGTCAGTGTTAGTAATGGCCCTGGCTATAGTGTA

ATCAAGGAGCCACAGAATTATCAAGAAGGAGATGCTAATCGAAATATTACTAACAAGAAAGAAATGTCTACTTACACTAGCAAGACTCTTGCTCACAATA

AAGAAAAACCGTATAAATGTAAAGACTGTGGGAAGTGCTTTGGTTGTAAGTCAAACCTTCATCAGCATGAGAGTATTCACACTGGAGAGAAGCCCTATGA

ATGTAAGGACTGTGGGAAGACCTTCAGACTCCCTCAGATGCTTTCAAGACATCAGAAGTCTCACAGTGATGAGAGACCTTTTGAGTGTAATATATGTGGA

AAGTCTTTTCATCTTCCTACCCTGCTTCAGTACCATAAAAATATTCATACAGGTTTAAAACCATTTGAATGTGAGGAGTGTGGGAAGTCCTTCAACCGCA

TCTCTACCCTTTTTCAGCATAGGACTATTCATGCTGGTATGAAACCGTATAAATGTAATGTGTGTGGGAAAGCCTTTAATCGTCGCTCAAACCTCCTGCA

ACATCAGAAAATTCATTCTGAGGACAGACCTTTTCATTGTAAGGTGTGTGGAAAGGCCTTCACTGTGCTGGCTCAGCTTACTCGGCACGAGAACATTCAC

ACTGAAGACAAATCGTTTGAATGTAAGCAGTGTGGTAAGATATTTAGTAATGGCTCTTACCTCTTACGACACTACGATACTCACACCAATGAGAAACCCT

TTGAGTGTAATATATGTGGCAAGGCTTTTAGGCTTCATCTATACCTTTCTGAGCATCAGAAAACTCACACCGATGAGAAGCCTTTCAAGTGTAAGCTGTG

TGAGTCAGCCTTCAGACGTAAGTACCAGCTCAGTGAACATCAGAGAATTCACACTGATGTGAAACCCTATCAGTGCAAGGATTGTGGGAAATTCTTTCGT

CGACGATCAAATTTTACTGAACATCAGAGTATTCACACTGGAAAGAAACCCTTTGAGTGTAAGGACTGTGGGAAGGTCTTTAGACTAAATATACATCTCA

TTCGACATCAGAGATTTCATAGTGATGAGAAGCCCTTTGAATGTAAAGAATGTGGAAAGGCTTTTCATTTTTCCAGCCAGCTTAATAACCATAAAACCAG

TCATACAGGTCAGACACCTTTTGAATGTAAAGAATGTGGGAAGTCGTTTAAGCGTGTCTCCAGCCTTGTGGAACATAGGATTATTCACAGTGGTGTGAAA

CCATATAAATGTAATGCGTGTGGAAGAGCCTTCAATCGTCGCTCAAACCTCATGCAACATGAGAAAATTCATTCTGATGAGAGACCCTTTGAGTGTAAGG

ACTGTGGAAAGGCCTTCACTGTTCTGGCTCAGCTCACACGGCACCAGACGATTCATAATGGAAAGAAATCATATGAATGTGAGCAGTGTGGGTCAGCCTT

CAGACTCCCGTACCAACTCACTCAACATCAGAGAATTCATTATGATGTGAAGCCATTTCAGTGCAAGGAATGTGGAAAGGGCTTTGTTCGTAGTACAGGC

CTTAGAATTCATGAAAGGATCCACACTGGTGAGAAGCCCTTTCAGTGTAAGGAGTGTGGAGAAGCCTTTCAGTATCATTACCAATTTCTTGGACACTTTA

GAATTCATACTGGCAAGAACCCTTATGAATGTAGTGAATGTGGGAAGTACTTTACTTATGGTCGAGACCTTAAAGTACATCAGAGTATTCACAATCTTGA

GAAACCGTAAGAATGTGGGAAGACCTTCAGTTGAAAATCAAAGGTGGTTTGACATGCTAAACTTAATATTATGAAGAAGAAGCCTTACAATGCTTATAAG

GAATGTGGAAAGCCTTCAGTAATTCTAAGCTACCTGTATATCAGAGAATTCATACTGGTCTGAAGCACTGTTGATATGAAAATTGTGAGAAAGTTTAGAT

TAAGTTCAGCCTTCAGTGTACATCAAAGAATTCATATTGGTCTGAAACCCCATCACTGTAAAGAATGTGGAAAGACCCGCAACTGAAGCTCAGGCCTTCA

GCATAAAAGTATCCATGCTGTCGTGAAACACTATGCAAGGAGTGTGTAAACATTTATAGAATTCATTCTGAAAACTCATGAAGGAGTCCATATAGGTCTG

AAACCATAAGGATGTGAAAAAAATTTTATTGTTAAATGGTGAGCTTATACAGCATGAGAAAAGGAAGACGGATAAGACTTTATGGAAATTTTACTGAACA

TCAAAGAAGTCATTAACAAACTGGGACTGAAAGGAGTCTGGGAAGAACTTTAATCTATCATAGGATTTAACCAACATCTGAGTGTTCATATACTTGTGAA

CCAAAAAATCCTTAGAGAATGAGAGTGGGAATTCTGTTCACAGAAAATACTGTTGAGAAGGACAGAAAGAGATATTGTAGCCTTCATGCTCCTAAGTTAG

CTCATCTTTAATACTACTGTTAATTGCATAAGCTTAATTCACCAAACACAATTCAGCTCACTTAGGAAGAACAGTTATTGAGACTATTATTATTCGAGGC

ACCTTGCCACCAATTACATCCCATGGCTCCTGTGCTATTACACTGGATGTTTGCTTTCTTTCTGCATAGTTCATGGTGAGCACGGTACCAGGCGGATGTG

TGGAAACGGGGTCATAATGGATAGAGAATCCTTGAGAGTATTTGGTATGTTCTGTGAAGTAGCTTCTACAGTGTTGGTGCTCTCACGGGCGTTACTGTAA

CGGATATGAAAGACAAGCTGTGTCGTAGATAGTTTAGAAAAGCCTCATGCAGCCCTCCAGTATTAAATTCTAAATATTTCCTTCTGGGTAAAATCTAATA

GATGAACAGGTACATGAAAGCATTTTTATTCTCAATCCGTTTCTTTAGCTTTCGTGCAGAGATGTCTATAAACTAGCTGTTGGTGAATAAGTACTTTTAA

ACGGGGATAAACACATTTAACTTTCAAAAGCTAAAATCCTGTAATTTATGTTCTCTGCCCAAACATTAAGATAAAATGCATTTGTGACTCAGCAGGACAG

TGCAGTCCCCTCCATCTCATGCTGCTGAGACCATTTTAGGTTTGACTAGAATTTGATTTTAGATGGAGGAGATTCTTGGAGATTTACCCACCTCTAGTCT

GTGAGCCAGCGGTCAGGATGCTCCTGCTATTTTATTTTGGCTTCTCTTAGACTGCCTGCCTGTGCAAACTTTCCCCTTCCACTTAACTGCTTACCCTGGC

TTCTGTTAAACTGCCTGCTTGGGCAAATGCTCCCCCTGTAGCTGCTGAGCAAGATATCAGAATGTGGTTCTTGTTTTTAATAGCCCCTTGCTGTAAATGC

TTGTGAGTGTATATGGATCCCGAATAAATGAGTGTAGTCCCAGCCAACTGGAATAAAGACTTTCAGTTGGCTATAATTGTGTCTGGCTCCATTTTCTCTG

GTGGACTCTCCATAAACATGAACAAAAATAGCCCAATTTGAAGCCAGGTGTAAAAATACATGTGAGAAAATCTTCATACATATGTAAAAGAAGAGTCAAA

AACACACTTGTGTTTCATCACCTGAATTAAAAACTGTTAGTTTGCTGGGCAGTGGTGGCACACTTTAATCCCAGCACTCGGGAGGTAGAGGCAGGTGGAT

TTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGTCAGGGCTACACAGAGAAACCCTGTCTCGGGAAACCAACCAACCAAACAAAAA

AAACCTGTTAGTTTACCATGTTAACCTTGTTTTTCTGTATATATGGGTTTGGGGACTGTAGTGTTAAGAATATGTTTTAGGGGCTGGAGAGATGGCTCAG

TGGTTAAGAGCGCCGACTGCTCTTCCAAAGGTCCTGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACGAAATCTGATGCCCTCTT

CTGGAGTGTCTGAAGACAGCTACAGTGTACTTACATATAAAAAATAAATATATTTAAAAAAAAAAAGAATATGTTTTAGAATCTTGAGTGTGGTAGTGCA

TTCCTAAAACCCAGTTCTAGGAAAGCTTATGCAGAAGGATCAAGTTGGACTTTAAGTTGTGATTTTAAGTCCAACTTTGATTGTGTAGAGATCCTTTCTC

AAAAAAAAAGTTGTAGATATGACTGACATTTTATCCCTTATGATATCAGCCAAGATGGCATATCATTTATACCACAGATCCATCCTTACTCTTAAGGAAA

TGATTCAGAATTATAACTTTCAGAAATCTGTCATTGGTTTCTAAAGTGTCATTTTTACAAATGTGTGCATCCTAAGAAGAATCTAATGCAGATTTGGCCT

TCCTCTTGCCTTTATTAACATTTCAGAGTTGATTGAACCCAGGGTCTTGTGTGGGGTAAGCATGAACTTAAGTCACCCGGCTGCATTCCTGCCCTTTAGC

CTGTGTCTTCTATCCAAGAGAAGTTAGGTTCAGTTGAAACATTTGAGGTAAGAACACATTGTAGATGGCATGTTTTGTTGCCAGCGTGTCCAGAAACACT

AAGGTGGCAGCTACCACATTAGGTCAGATGGTAGCTGTCAGAGGCCCCCTAAAAAGTCTAATATATATTTATAGATATGGAGACTTTAATCCTGGGTCCA

ATATGAATAAAAATTGAAATCAACTTAATGAATAGCATAATGCTATCATAATTCAACGTGTTTGGTTTAACTGGTACAATACTCAGTAAAAAATTAAAAC

TATTCAGTGCAATCAGAAACTAAGATTTTGGCTGGAACCTTGTTTTTGTTGGCACTTTAGCTCCCTTTAGTGTCAAAAGAGAAAAATCTTTCAAGAGCAT

AAATTTTTGATTTTTTTTCCACTTAGGTTTCTCTAATCATTTGTATTTGGTATTTTAAAGGATTCTAAAGATATTATGGTGCCATCTTGAAAATTCCCTC

ATTTTGTTAGTGCCTATCTTGAATGATAGCGTCATGTGTATGATCCTTTTAAGAGGGATTGCTCTGAGTCAACTTCATCATGGTGAAAAAGCCTTGTCTA

GTAGAAAATTCAGTAATGGGTATATATTGAGCATATTATTGTTTCCACCTGTATTAAACAGGGTTCTCTTGAGTTACAGCACTTATACAATGCTTCTCTC

CCCTGTATATGTAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTATCACACCACCACCAACAACAAAAATAACCCAGCCAAACAAAACAAAACA

AACCCCAACAACTGGAAGACATTTGTCATCCTGCAAGATACTGATAGTCTATCTCATGCTTGTGTTACATGGAAGCACAGATGAACTCATCACATGCATG

TTACAGGATACTGTGTGGTCATGTGGAAAGATGGATCCATGTGTTTGTACAATGTCAGTTGTTGAATAAGCAATAAATTTACAACCTTT
Translation
 - UNI10719 - - UNI15802 - MANSSSQHMVC - UNI15802 - - UNI18002 - GSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLET

YSNLVAVV - UNI1498 - VGRCIPKPDLIVLLEQEKEPWMAVKKETGRPSQG - UNI6799 - - UNI36543 - GLETGFEAENRSPKNHVYN

KKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQNYQEGDANRNITNKKEMSTYTSKTLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHTGEKPYECKD

CGKTFRLPQMLSRHQKSHSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFECEECGKSFNRISTLFQHRTIHAGMKPYKCNVCGKAFNRRSNLLQHQK

IHSEDRPFHCKVCGKAFTVLAQLTRHENIHTEDKSFECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKAFRLHLYLSEHQKTHTDEKPFKCKLCESA

FRRKYQLSEHQRIHTDVKPYQCKDCGKFFRRRSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQLNNHKTSHTG

QTPFECKECGKSFKRVSSLVEHRIIHSGVKPYKCNACGRAFNRRSNLMQHEKIHSDERPFECKDCGKAFTVLAQLTRHQTIHNGKKSYECEQCGSAFRLP

YQLTQHQRIHYDVKPFQCKECGKGFVRSTGLRIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHTGKNPYECSECGKYFTYGRDLKVHQSIHNLEKP
Transcript ENSMUST00000042641
Sequence
GCGGACGGTCGGGTCTTTCTGGTCTGAGTAGGGAATTGCTTTGTGTCTTCGGTCTCTGCAGAGTAAGGCCGGGAGTCCGGGTGTGGGTGTGGACGGTGGG

GTGGATGGATGTTGATGCGTGTGTGAGTGTTTAGGGACGGTGCTGTGTGTGCGCGCGCGCGTCTCTGCGTACGCACCTTGAGCTATTTGCATTATCACCG

TGCTTGTCGCTTTCTCTCGCGGCCACCAGCAGAGGACCAAGCTTCACTGAGGAGAG - UNI10719 - - UNI15802 - GGGAGGAAGCCTGAAGA

AGAATGGCCAACTCTAGTTCTCAACACATGGTCTGT - UNI15802 - - UNI18002 - GGGTCAGTGACATTTAGGGATGTGGCTGTTGACTTCT

CTCAGGAGGAGTGGGCCTGCCTGGATGCTACTCAGAAGGTCTTATACAGGAACATAATGTTGGAGACCTACAGCAACCTGGTCGCAGTGG - UNI1498

 - TGGGACGTTGCATTCCCAAGCCAGATCTGATCGTCTTACTAGAGCAGGAGAAAGAGCCCTGGATGGCTGTGAAGAAAGAAACAGGCAGGCCGAGCCA

AG - UNI6799 - - UNI36543 - GTTTGGAGACAGGTTTTGAAGCTGAAAATAGATCTCCAAAGAATCATGTTTATAATAAAAAGTTACCCAAAC

AAACCATACAGCAATTAAGTAAAACTTCGGACGTCCAGGGCGTCAGTGTTAGTAATGGCCCTGGCTATAGTGTAATCAAGGAGCCACAGAATTATCAAGA

AGGAGATGCTAATCGAAATATTACTAACAAGAAAGAAATGTCTACTTACACTAGCAAGACTCTTGCTCACAATAAAGAAAAACCGTATAAATGTAAAGAC

TGTGGGAAGTGCTTTGGTTGTAAGTCAAACCTTCATCAGCATGAGAGTATTCACACTGGAGAGAAGCCCTATGAATGTAAGGACTGTGGGAAGACCTTCA

GACTCCCTCAGATGCTTTCAAGACATCAGAAGTCTCACAGTGATGAGAGACCTTTTGAGTGTAATATATGTGGAAAGTCTTTTCATCTTCCTACCCTGCT

TCAGTACCATAAAAATATTCATACAGGTTTAAAACCATTTGAATGTGAGGAGTGTGGGAAGTCCTTCAACCGCATCTCTACCCTTTTTCAGCATAGGACT

ATTCATGCTGGTATGAAACCGTATAAATGTAATGTGTGTGGGAAAGCCTTTAATCGTCGCTCAAACCTCCTGCAACATCAGAAAATTCATTCTGAGGACA

GACCTTTTCATTGTAAGGTGTGTGGAAAGGCCTTCACTGTGCTGGCTCAGCTTACTCGGCACGAGAACATTCACACTGAAGACAAATCGTTTGAATGTAA

GCAGTGTGGTAAGATATTTAGTAATGGCTCTTACCTCTTACGACACTACGATACTCACACCAATGAGAAACCCTTTGAGTGTAATATATGTGGCAAGGCT

TTTAGGCTTCATCTATACCTTTCTGAGCATCAGAAAACTCACACCGATGAGAAGCCTTTCAAGTGTAAGCTGTGTGAGTCAGCCTTCAGACGTAAGTACC

AGCTCAGTGAACATCAGAGAATTCACACTGATGTGAAACCCTATCAGTGCAAGGATTGTGGGAAATTCTTTCGTCGACGATCAAATTTTACTGAACATCA

GAGTATTCACACTGGAAAGAAACCCTTTGAGTGTAAGGACTGTGGGAAGGTCTTTAGACTAAATATACATCTCATTCGACATCAGAGATTTCATAGTGAT

GAGAAGCCCTTTGAATGTAAAGAATGTGGAAAGGCTTTTCATTTTTCCAGCCAGCTTAATAACCATAAAACCAGTCATACAGGTCAGACACCTTTTGAAT

GTAAAGAATGTGGGAAGTCGTTTAAGCGTGTCTCCAGCCTTGTGGAACATAGGATTATTCACAGTGGTGTGAAACCATATAAATGTAATGCGTGTGGAAG

AGCCTTCAATCGTCGCTCAAACCTCATGCAACATGAGAAAATTCATTCTGATGAGAGACCCTTTGAGTGTAAGGACTGTGGAAAGGCCTTCACTGTTCTG

GCTCAGCTCACACGGCACCAGACGATTCATAATGGAAAGAAATCATATGAATGTGAGCAGTGTGGGTCAGCCTTCAGACTCCCGTACCAACTCACTCAAC

ATCAGAGAATTCATTATGATGTGAAGCCATTTCAGTGCAAGGAATGTGGAAAGGGCTTTGTTCGTAGTACAGGCCTTAGAATTCATGAAAGGATCCACAC

TGGTGAGAAGCCCTTTCAGTGTAAGGAGTGTGGAGAAGCCTTTCAGTATCATTACCAATTTCTTGGACACTTTAGAATTCATACTGGCAAGAACCCTTAT

GAATGTAGTGAATGTGGGAAGTACTTTACTTATGGTCGAGACCTTAAAGTACATCAGAGTATTCACAATCTTGAGAAACCGTAAGAATGTGGGAAGACCT

TCAGTTGAAAATCAAAGGTGGTTTGACATGCTAAACTTAATATTATGAAGAAGAAGCCTTACAATGCTTATAAGGAATGTGGAAAGCCTTCAGTAATTCT

AAGCTACCTGTATATCAGAGAATTCATACTGGTCTGAAGCACTGTTGATATGAAAATTGTGAGAAAGTTTAGATTAAGTTCAGCCTTCAGTGTACATCAA

AGAATTCATATTGGTCTGAAACCCCATCACTGTAAAGAATGTGGAAAGACCCGCAACTGAAGCTCAGGCCTTCAGCATAAAAGTATCCATGCTGTCGTGA

AACACTATGCAAGGAGTGTGTAAACATTTATAGAATTCATTCTGAAAACTCATGAAGGAGTCCATATAGGTCTGAAACCATAAGGATGTGAAAAAAATTT

TATTGTTAAATGGTGAGCTTATACAGCATGAGAAAAGGAAGACGGATAAGACTTTATGGAAATTTTACTGAACATCAAAGAAGTCATTAACAAACTGGGA

CTGAAAGGAGTCTGGGAAGAACTTTAATCTATCATAGGATTTAACCAACATCTGAGTGTTCATATACTTGTGAACCAAAAAATCCTTAGAGAATGAGAGT

GGGAATTCTGTTCACAGAAAATACTGTTGAGAAGGACAGAAAGAGATATTGTAGCCTTCATGCTCCTAAGTTAGCTCATCTTTAATACTACTGTTAATTG

CATAAGCTTAATTCACCAAACACAATTCAGCTCACTTAGGAAGAACAGTTATTGAGACTATTATTATTCGAGGCACCTTGCCACCAATTACATCCCATGG

CTCCTGTGCTATTACACTGGATGTTTGCTTTCTTTCTGCATAGTTCATGGTGAGCACGGTACCAGGCGGATGTGTGGAAACGGGGTCATAATGGATAGAG

AATCCTTGAGAGTATTTGGTATGTTCTGTGAAGTAGCTTCTACAGTGTTGGTGCTCTCACGGGCGTTACTGTAACGGATATGAAAGACAAGCTGTGTCGT

AGATAGTTTAGAAAAGCCTCATGCAGCCCTCCAGTATTAAATTCTAAATATTTCCTTCTGGGTAAAATCTAATAGATGAACAGGTACATGAAAGCATTTT

TATTCTCAATCCGTTTCTTTAGCTTTCGTGCAGAGATGTCTATAAACTAGCTGTTGGTGAATAAGTACTTTTAAACGGGGATAAACACATTTAACTTTCA

AAAGCTAAAATCCTGTAATTTATGTTCTCTGCCCAAACATTAAGATAAAATGCATTTGTGACTCAGCAGGACAGTGCAGTCCCCTCCATCTCATGCTGCT

GAGACCATTTTAGGTTTGACTAGAATTTGATTTTAGATGGAGGAGATTCTTGGAGATTTACCCACCTCTAGTCTGTGAGCCAGCGGTCAGGATGCTCCTG

CTATTTTATTTTGGCTTCTCTTAGACTGCCTGCCTGTGCAAACTTTCCCCTTCCACTTAACTGCTTACCCTGGCTTCTGTTAAACTGCCTGCTTGGGCAA

ATGCTCCCCCTGTAGCTGCTGAGCAAGATATCAGAATGTGGTTCTTGTTTTTAATAGCCCCTTGCTGTAAATGCTTGTGAGTGTATATGGATCCCGAATA

AATGAGTGTAGTCCCAGCCAACTGGAATAAAGACTTTCAGTTGGCTATAA
Translation
 - UNI10719 - - UNI15802 - MANSSSQHMVC - UNI15802 - - UNI18002 - GSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLET

YSNLVAVV - UNI1498 - VGRCIPKPDLIVLLEQEKEPWMAVKKETGRPSQG - UNI6799 - - UNI36543 - GLETGFEAENRSPKNHVYN

KKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQNYQEGDANRNITNKKEMSTYTSKTLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHTGEKPYECKD

CGKTFRLPQMLSRHQKSHSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFECEECGKSFNRISTLFQHRTIHAGMKPYKCNVCGKAFNRRSNLLQHQK

IHSEDRPFHCKVCGKAFTVLAQLTRHENIHTEDKSFECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKAFRLHLYLSEHQKTHTDEKPFKCKLCESA

FRRKYQLSEHQRIHTDVKPYQCKDCGKFFRRRSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQLNNHKTSHTG

QTPFECKECGKSFKRVSSLVEHRIIHSGVKPYKCNACGRAFNRRSNLMQHEKIHSDERPFECKDCGKAFTVLAQLTRHQTIHNGKKSYECEQCGSAFRLP

YQLTQHQRIHYDVKPFQCKECGKGFVRSTGLRIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHTGKNPYECSECGKYFTYGRDLKVHQSIHNLEKP

For any suggestions or comments, please send an email to unitrap@crg.es