Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037643 (Prkci)
Chromosomal location
Chr 3: 30894669 - 30951659 (+)
Description
protein kinase C, iota Gene [Source:MGI Symbol;Acc:MGI:99260]
RefSeq_peptide
NP_032883.2 
UniGene
Mm.291554 Mm.412704 Mm.474564 
MGI
MGI:99260 
Uniprot/SWISSPROT
Q62074 
Uniprot/SPTREMBL
Q3TJJ5 Q3UMD5 Q3UGW9 Q5DTK3 
Human Ortholog
ENSG00000163558 (PRKCI)
Omim not available
UniTrap UNI9316
Vector Insertion
Chr 3: 30895008 - 30917471
Public Clones (sanger) XH339 (baygenomics) E064G12 (ggtc) 3SE223B01 (ggtc) E069A10 (ggtc)
E021F05 (ggtc) E113B06 (ggtc) 5SE152H04 (ggtc) E021F02 (ggtc) PST7472-NL (escells)
IST14382H8 (tigm) IST12438H6 (tigm) IST14276G2 (tigm) IST14212E4 (tigm)
IST14959H7 (tigm) IST12846F8 (tigm) IST14141C9 (tigm) IST14370H12 (tigm)
Private Clones OST452941 (lexicon) OST426274 (lexicon) OST422984 (lexicon) OST403579 (lexicon)
OST372837 (lexicon) OST366799 (lexicon) OST360006 (lexicon) OST346215 (lexicon)
OST323481 (lexicon) OST302362 (lexicon) OST280097 (lexicon) OST264095 (lexicon)
OST259779 (lexicon) OST248802 (lexicon) OST233465 (lexicon) OST188853 (lexicon)
OST171253 (lexicon) OST154989 (lexicon) OST134812 (lexicon) OST118829 (lexicon)
OST105456 (lexicon) OST104540 (lexicon) OST66797 (lexicon) OST63896 (lexicon)
OST56195 (lexicon) OST41240 (lexicon) OST33927 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI278
Vector Insertion
Chr 3: 30917594 - 30924051
Public Clones GC0451 (tigem) D186F10 (ggtc) D183G02 (ggtc) D179G09 (ggtc) CMHD-GT_410G11-3 (cmhd)
IST15059C5 (tigm) IST10818F3 (tigm)
Private Clones OST372245 (lexicon) OST347017 (lexicon) OST311655 (lexicon) OST302942 (lexicon)
OST295066 (lexicon) OST241484 (lexicon) OST230237 (lexicon) OST186607 (lexicon)
OST174741 (lexicon) OST41311 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17288
Vector Insertion
Chr 3: 30924142 - 30925174
Public Clones CMHD-GT_437C3-3 (cmhd) CMHD-GT_408B4-3 (cmhd)
Private Clones OST445898 (lexicon) OST297394 (lexicon) OST244083 (lexicon) OST198292 (lexicon)
OST38026 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9342
Vector Insertion
Chr 3: 30925226 - 30928407
Public Clones XH694 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17995
Vector Insertion
Chr 3: 30940452 - 30942612
Public Clones not available
Private Clones OST432391 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37275
Vector Insertion
Chr 3: 30942739 - 30943803
Public Clones CMHD-GT_454H5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046401
Sequence
AGCGTGGTGGGAGGAGCCGCGGCGGGAGGCGTGTTGTGCCGGGCGGAGGGAGGAGCGCTGGGGCTCGGGCTTGGCGGCGAAGCGACCCCTTGCTCGCTCC

GCGCCGCGGGCTAGGCGTGTTGGTCGGCGAGGCGGGCGGCCACGGCTTCCCGACAGGCTCGGGAGGCCGAGACCCTCGCGGCGCCCGGCGCTGCCCCGGC

CCCCTCGGCCTCCTGCGGCGAGGCGGGGGAGTGAGGAGATGCCGACCCAGAGGGACAGCAGCACCATGTCCCACACGGTCGCGTGCGGCGGCGGCGGGGA

CCATTCCCACCAGGTCCGGGTGAAAGCCTACTACCGCGG - UNI9316 - GGATATTATGATAACACACTTTGAGCCTTCCATCTCCTTTGAGGGACT

TTGCAGTGAGGTTCGAGATATGTGTTCTTTTGACAATGAGCAGCCGTTCACCATGAAATGGATAGATGAGGAAG - UNI278 - GAGACCCATGTACA

GTGTCTTCTCAGTTGGAGTTAGAAGAGGCTTTCAGGCTGTACGAGCTGAACAAGGATTCTGAACTCTTGATTCATG - UNI17288 - TATTTCCATG

TGTACCAGAGCGTCCTGGAATGCCTTGCCCAGGGGAAGACA - UNI9342 - AGTCCATTTACCGGAGAGGGGCACGCCGGTGGAGAAAGCTGTATTG

TGCAAATGGCCACACTTTTCAAGCCAAACGTTTCAATAGG CGCGCCCACTGTGCCATCTGCACAGACAGAATCTGGGGCCTCGGACGACAAGGATACAA

GTGCATCAACTGCAAACTGCTGGTTCATAAGAAGTGCCACAAGCTGGTCACAATTGAGTGTGGGCGGCACTCTTTGCCACCG GAACCCATGATGCCAAT

GGACCAGACCATGCATCCAGACCACACACAGACAG TAATTCCATATAATCCTTCAAGTCATGAGAGTTTGGACCAAGTTGGTGAAGAAAAGGAG GCAA

TGAACACCAGGGAGAGTGGTAAAGCGTCGTCCAGTCTAGGTCTGCAGGATTTCGATTTGCTTCGAGTTATAGGGAGGGGAAGTTACGCCAAAGTACTGTT

GGTTCGGTTAAAGAAAACAGATCGCATTTATGCAATGAAAGTTGTGAAGAAAGAGCTCGTCAATGACGATGAG GATATCGATTGGGTGCAGACAGAGAA

GCATGTGTTTGAGCAGGCGTCCAATCACCCTTTTCTTGTCGGGCTGCATTCTTGCTTCCAGACAGAAAGCAG GTTGTTTTTTGTCATAGAATATGTAAA

TGGAGGGGACCTCATGTTTCATATGCAGCGACAGAGAAAACTTCCTGAAGAGCATGCCAG GTTTTACTCTGCAGAAATCAGTCTAGCACTGAATTATCT

TCATGAGCGAGGGATAATTTATAGAGATTTGAAGTTGGACAATGTACTGCTAGACTCTGAAGGACACATTAAACTCACTGACTACGGCATGTGTAAG GA

AGGATTGCGGCCTGGAGACACAACCAGCACTTTCTGCGGCACTCCCAATTACATTGCTCCAGAGATCTTAAGAGGAGAAGATTATG - UNI17995 - 

GCTTCAGCGTTGACTGGTGGGCTCTTGGAGTGCTTATGTTTGAGATGATGGCGGGAAGGTCTCCGTTTGATATCGTTGGGAGCTCTGACAATCCTGACCA

AAACACAGAGGATTATCTATTCCAAG TCATTTTGGAAAAGCAGATCCGCATCCCGCGTTCTCTGTCTGTAAAAGCAGCAAGTGTACTGAAGAGTTTTCT

CAACAAG GACCCAAAGGAACGATTGGGTTGTCACCCTCAAACTGGATTTGCTGACATTCAAGGACATCCATTCTTCAGAAATGTGGACTGGGACATG A

TGGAGCAAAAGCAGGTGGTTCCACCCTTTAAACCAAACATTTCTGGAGAATTTGGTTTGGATAATTTCGATTCTCAGTTTACTAATGAACCAGTCCAGCT

CACTCCAGATGATGA TGACATTGTGAGGAAGATTGATCAGTCTGAATTTGAAGGTTTTGAGTATATCAACCCCCTCTTGATGTCTGCAGAAGAGTGTGT

CTGATTCTGCTTGCCGCCATTCAGTGCATGGATATCCACCCGTCAGCCTGCTCACAGTTAGCATTTTATGTTGCCCCTGCAGAAGTCGCTCTCGGTATCC

TGTTGGAGACTAGGAATCATACAGATAAATAGAACTAAGAAACAGAAGCTAGCTTCCTGACAATCATGTCGACCCTGCTTATGCTTGCTCTCCAGACACT

CCTAATGAGGAAGGACGGTCTTTGTGTAAAGGAAACAACACAGCTTGTCAAAGAAAGCCTCTGCTGCGTTGTGACACTCGACGGGATGACATCATCAGTC

TCCCACAGTTGTTGTCACTTTGTGTTAAGTCATTGAAGGCTTAATTGCGCAGTGGAGGGCCATGCAGAGTAGTGCATCTGCTAGTGTTACTGGTTGCCGA

GGTCCCTCAGTTTAAGATTTCCTCCTATAAATAAATCTTCTCATTACTTTGGGTAATTAATAATTATGAATTGGGTTCTAAATTATTAGCTGTGTTTCAA

AAACTGGCACAGTGATTTATTTATTTGTTTTTAATTTTTTAAAATTATTTTTACACTAAGGGGTTAGCTTCTGAGCTTGCCTTTTCAGTGAAAACTAGCA

TGCTGATGTGTGTTCAGAGGCAGGATTCGAGAGTGGCAGCTGCTCACATACAGGAAAAAGTAGACGTCTAAAGTAGCTACAGAAAGAACGATTGTAGCAT

TTTCTTTCTTACTGTAGAGTAAATCCTACAGTTGGTGTTTAAGATTTGATGTAAATAATGAGGAGGCTCTCACTTCTTAGCCAGCTTAGAAAAGCATTCC

GTTTATTCAGGGGAAGCGGAGTGAATATATTTTTATTATTATTTAGTATATGGGAAAATAAATTATCTTCTGAGTAGAATGTCTTAACTACTTTTGGTTC

CTTCTCCAGAGTACATTATCTGTACTTTGACCTTTCGTGGAGTCTGCGGTGAAATTCAAGACCAATGATGATGACCACGGATAACTATGTAACACACACA

CACACACACAGTTCCAGCTCTTCCTGAGCTCCTATGTCATAGCTAACATGTGATACAGAGTGAAATCCATTTCAGGGCAGGGTTCCTCAGTTCTCTACAC

TATTTTTATTAACAGTAAGTAGTATTTAGCAATCTCTTATTTAAAGAAGTACCGTTTTAAGCACCATTCTGCTGTTTATTTTAAATATTTTTATATAAAG

GACTTTAAAATGATCGTCTAAATAAGCTACAGTTGTCAAATCAGTAAATTTAACTTTAGGAACGCCGCGCAGTGCTGAGCTTGTGATGATTTAAAACCTG

TAGGCATTTGAAAATCACTTGGAGAATGCTACGTTTCATTAGAAGTGTGAGTTGTGTCAAGTTTGTGTCATGCATTTTCAAGTAATGTAAGACAGAGAGC

AGTGAGAACCCCCATTGATAAAGCCAACAAGGGGCCATCGAGGCCACTTGCCAAAACCTGAAGACCTGATGATGCCTGCAGCCCACGGGCTGGTGGCCAT

GGCGCGCGCAGCCCTCCCCTGCAGGACATAAATGCGAGGGAGCAGACCAATAAGTGCAGTGCGTGCGCTGACACATTTCATGTTGAAGTGTGTGTTTCCC

CTAAGACCTGGAACAGCTGTCTTAATCTAAAGGCAGCATTCACGCCCTAAGCTGCTAGGAGCTCGGGGGTGTGTATGCTGTGACCTAAGTGGTGCTCTCC

CTTGGGGCATTTTAGACTGAGAGCTGTTGAAGTGCACAGTGTCCAGCCTGCCTGGGACTCTTTGGGGCTTTGTATTCCATTTTGAGAAACTTTTTCTTCA

GGTTATTCTTTTTCTTGTGGCCATATTTCTTATTGGAGTGTGAGTCTGTGTTTTTTTGTGAAAAACATTTTAAGAAAGGATAACCAGTGAATTATCATGC

ATTTGTCAACAAACTTAGATGAGTAAATTCAAGTTGTATGTCTTCCCTACCCTCACCCACAACAAAACCTGTACATTTTCTGCCAATAACATTTAAATGA

TGAACAGTTTTCTGTGATAAGGTTTTAACCATAATTAATGGTGGTCTTTGTTTTTAAATCTTTTTTTTTTCTTATTGTTGTTAACTAATAAGACTTACTA

TGTGTGTTTTATACAGAATTATTACAGATGATTTTAATTCAGTTCTAGTTTTCAGTCCTTAAGTGCCATGCAAACTCTCTGTATGTGGTGGAAGCCTCCT

TCTCTCAGAGTCTCCGGGGAGACAGGCAGAGGGATGGGCGCTTGGTGTCTTAGACACCACTTATGTTGCATAAGCTTGTGATCAGATCGGTTTATCACAT

GCAGCTGGATGGGTGTCTAGTTATCTGTGTCCCTGTTGCCAGTACTTATTTAGAAAATTGTTTTAATTTTTATCATGTAGAACACTGCCTTGTTCACTAT

AATGTAATCTGTATTTGTATAATTTTTTTTACATTAAAATCTTTAAATAAAATGTTTAATACCT
Translation
MSHTVACGGGGDHSHQVRVKAYYRG - UNI9316 - GDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEG - UNI278 - GDPCTVSS

QLELEEAFRLYELNKDSELLIHV - UNI17288 - VFPCVPERPGMPCPGEDK - UNI9342 - KSIYRRGARRWRKLYCANGHTFQAKRFNR RA

HCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPP EPMMPMDQTMHPDHTQTV VIPYNPSSHESLDQVGEEKE AMNTRESGKASSSL

GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDE DIDWVQTEKHVFEQASNHPFLVGLHSCFQTESR RLFFVIEYVNGGDLMFHMQR

QRKLPEEHAR RFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCK EGLRPGDTTSTFCGTPNYIAPEILRGEDYG - UNI17995 

- GFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQV VILEKQIRIPRSLSVKAASVLKSFLNK DPKERLGCHPQTGFADIQGHPFFRNV

DWDM MEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDD DDIVRKIDQSEFEGFEYINPLLMSAEECV
Transcript ENSMUST00000108249
Sequence
AGCGTGGTGGGAGGAGCCGCGGCGGGAGGCGTGTTGTGCCGGGCGGAGGGAGGAGCGCTGGGGCTCGGGCTTGGCGGCGAAGCGACCCCTTGCTCGCTCC

GCGCCGCGGGCTAGGCGTGTTGGTCGGCGAGGCGGGCGGCCACGGCTTCCCGACAGGCTCGGGAGGCCGAGACCCTCGCGGCGCCCGGCGCTGCCCCGGC

CCCCTCGGCCTCCTGCGGCGAGGCGGGGGAGTGAGGAGATGCCGACCCAGAGGGACAGCAGCACCATGTCCCACACGGTCGCGTGCGGCGGCGGCGGGGA

CCATTCCCACCAGGTCCGGGTGAAAGCCTACTACCGCGG - UNI9316 - GGATATTATGATAACACACTTTGAGCCTTCCATCTCCTTTGAGGGACT

TTGCAGTGAGGTTCGAGATATGTGTTCTTTTGACAATGAGCAGCCGTTCACCATGAAATGGATAGATGAGGAAG - UNI278 - GAGACCCATGTACA

GTGTCTTCTCAGTTGGAGTTAGAAGAGGCTTTCAGGCTGTACGAGCTGAACAAGGATTCTGAACTCTTGATTCATG - UNI17288 - TATTTCCATG

TGTACCAGAGCGTCCTGGAATGCCTTGCCCAGGGGAAGACA - UNI9342 - AGTCCATTTACCGGAGAGGGGCACGCCGGTGGAGAAAGCTGTATTG

TGCAAATGGCCACACTTTTCAAGCCAAACGTTTCAATAGG CGCGCCCACTGTGCCATCTGCACAGACAGAATCTGGGGCCTCGGACGACAAGGATACAA

GTGCATCAACTGCAAACTGCTGGTTCATAAGAAGTGCCACAAGCTGGTCACAATTGAGTGTGGGCGGCACTCTTTGCCACCG GAACCCATGATGCCAAT

GGACCAGACCATGCATCCAGACCACACACAGACAG TAATTCCATATAATCCTTCAAGTCATGAGAGTTTGGACCAAGTTGGTGAAGAAAAGGAG GCAA

TGAACACCAGGGAGAGTGGTAAAGCGTCGTCCAGTCTAGGTCTGCAGGATTTCGATTTGCTTCGAGTTATAGGGAGGGGAAGTTACGCCAAAGTACTGTT

GGTTCGGTTAAAGAAAACAGATCGCATTTATGCAATGAAAGTTGTGAAGAAAGAGCTCGTCAATGACGATGAG GATATCGATTGGGTGCAGACAGAGAA

GCATGTGTTTGAGCAGGCGTCCAATCACCCTTTTCTTGTCGGGCTGCATTCTTGCTTCCAGACAGAAAGCAG GTTGTTTTTTGTCATAGAATATGTAAA

TGGAGGGGACCTCATGTTTCATATGCAGCGACAGAGAAAACTTCCTGAAGAGCATGCCAG GTTTTACTCTGCAGAAATCAGTCTAGCACTGAATTATCT

TCATGAGCGAGGGATAATTTATAGAGATTTGAAGTTGGACAATGTACTGCTAGACTCTGAAGGACACATTAAACTCACTGACTACGGCATGTGTAAG GA

AGGATTGCGGCCTGGAGACACAACCAGCACTTTCTGCGGCACTCCCAATTACATTGCTCCAGAGATCTTAAGAGGAGAAGATTATG - UNI17995 - 

GCTTCAGCGTTGACTGGTGGGCTCTTGGAGTGCTTATGTTTGAGATGATGGCGGGAAGGTCTCCGTTTGATATCGTTGGGAGCTCTGACAATCCTGACCA

AAACACAGAGGATTATCTATTCCAAG TCATTTTGGAAAAGCAGATCCGCATCCCGCGTTCTCTGTCTGTAAAAGCAGCAAGTGTACTGAAGAGTTTTCT

CAACAAG GACCCAAAGGAACGATTGGGTTGTCACCCTCAAACTGGATTTGCTGACATTCAAGGACATCCATTCTTCAGAAATGTGGACTGGGACATG A

TGGAGCAAAAGCAGGTGGTTCCACCCTTTAAACCAAACATTTCTGGAGAATTTGGTTTGGATAATTTCGATTCTCAGTTTACTAATGAACCAGTCCAGCT

CACTCCAGATGATGA TGACATTGTGAGGAAGATTGATCAGTCTGAATTTGAAGGTTTTGAGTATATCAACCCCCTCTTGATGTCTGCAGAAGAGTGTGT

CTGATTCTGCTTGCCGCCATTCAGTGCATGGATATCCACCCGTCAGCCTGCTCACAGTTAGCATTTTATGTTGCCCCTGCAGAAGTCGCTCTCGGTATCC

TGTTGGAGACTAGGAATCATACAGATAAATAGAACTAAGAAACAGAAGCTAGCTTCCTGACAATCATGTCGACCCTGCTTATGCTTGCTCTCCAGACACT

CCTAATGAGGAAGGACGGTCTTTGTGTAAAGGAAACAACACAGCTTGTCAAAGAAAGCCTCTGCTGCGTTGTGACACTCGACGGGATGACATCATCAGTC

TCCCACAGTTGTTGTCACTTTGTGTTAAGTCATTGAAGGCTTAATTGCGCAGTGGAGGGCCATGCAGAGTAGTGCATCTGCTAGTGTTACTGGTTGCCGA

GGTCCCTCAGTTTAAGATTTCCTCCTATAAATAAATCTTCTCATTACTTTGGGTAATTAATAATTATGAATTGGGTTCTAAATTATTAGCTGTGTTTCAA

AAACTGGCACAGTGATTTATTTATTTGTTTTTAATTTTTTAAAATTATTTTTACACTAAGGGGTTAGCTTCTGAGCTTGCCTTTTCAGTGAAAACTAGCA

TGCTGATGTGTGTTCAGAGGCAGGATTCGAGAGTGGCAGCTGCTCACATACAGGAAAAAGTAGACGTCTAAAGTAGCTACAGAAAGAACGATTGTAGCAT

TTTCTTTCTTACTGTAGAGTAAATCCTACAGTTGGTGTTTAAGATTTGATGTAAATAATGAGGAGGCTCTCACTTCTTAGCCAGCTTAGAAAAGCATTCC

GTTTATTCAGGGGAAGCGGAGTGAATATATTTTTATTATTATTTAGTATATGGGAAAATAAATTATCTTCTGAGTAGAATGTCTTAACTACTTTTGGTTC

CTTCTCCAGAGTACATTATCTGTACTTTGACCTTTCGTGGAGTCTGCGGTGAAATTCAAGACCAATGATGATGACCACGGATAACTATGTAACACACACA

CACACACACAGTTCCAGCTCTTCCTGAGCTCCTATGTCATAGCTAACATGTGATACAGAGTGAAATCCATTTCAGGGCAGGGTTCCTCAGTTCTCTACAC

TATTTTTATTAACAGTAAGTAGTATTTAGCAATCTCTTATTTAAAGAAGTACCGTTTTAAGCACCATTCTGCTGTTTATTTTAAATATTTTTATATAAAG

GACTTTAAAATGATCGTCTAAATAAGCTACAGTTGTCAAATCAGTAAATTTAACTTTAGGAACGCCGCGCAGTGCTGAGCTTGTGATGATTTAAAACCTG

TAGGCATTTGAAAATCACTTGGAGAATGCTACGTTTCATTAGAAGTGTGAGTTGTGTCAAGTTTGTGTCATGCATTTTCAAGTAATGTAAGACAGAGAGC

AGTGAGAACCCCCATTGATAAAGCCAACAAGGGGCCATCGAGGCCACTTGCCAAAACCTGAAGACCTGATGATGCCTGCAGCCCACGGGCTGGTGGCCAT

GGCGCGCGCAGCCCTCCCCTGCAGGACATAAATGCGAGGGAGCAGACCAATAAGTGCAGTGCGTGCGCTGACACATTTCATGTTGAAGTGTGTGTTTCCC

CTAAGACCTGGAACAGCTGTCTTAATCTAAAGGCAGCATTCACGCCCTAAGCTGCTAGGAGCTCGGGGGTGTGTATGCTGTGACCTAAGTGGTGCTCTCC

CTTGGGGCATTTTAGACTGAGAGCTGTTGAAGTGCACAGTGTCCAGCCTGCCTGGGACTCTTTGGGGCTTTGTATTCCATTTTGAGAAACTTTTTCTTCA

GGTTATTCTTTTTCTTGTGGCCATATTTCTTATTGGAGTGTGAGTCTGTGTTTTTTTGTGAAAAACATTTTAAGAAAGGATAACCAGTGAATTATCATGC

ATTTGTCAACAAACTTAGATGAGTAAATTCAAGTTGTATGTCTTCCCTACCCTCACCCACAACAAAACCTGTACATTTTCTGCCAATAACATTTAAATGA

TGAACAGTTTTCTGTGATAAGGTTTTAACCATAATTAATGGTGGTCTTTGTTTTTAAATCTTTTTTTTTTCTTATTGTTGTTAACTAATAAGACTTACTA

TGTGTGTTTTATACAGAATTATTACAGATGATTTTAATTCAGTTCTAGTTTTCAGTCCTTAAGTGCCATGCAAACTCTCTGTATGTGGTGGAAGCCTCCT

TCTCTCAGAGTCTCCGGGGAGACAGGCAGAGGGATGGGCGCTTGGTGTCTTAGACACCACTTATGTTGCATAAGCTTGTGATCAGATCGGTTTATCACAT

GCAGCTGGATGGGTGTCTAGTTATCTGTGTCCCTGTTGCCAGTACTTATTTAGAAAATTGTTTTAATTTTTATCATGTAGAACACTGCCTTGTTCACTAT

AATGTAATCTGTATTTGTATAATTTTTTTTACATTAAAATCTTTAAATAAAATGTTTAATACCT
Translation
MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRG - UNI9316 - GDIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEG - UNI278 -

 GDPCTVSSQLELEEAFRLYELNKDSELLIHV - UNI17288 - VFPCVPERPGMPCPGEDK - UNI9342 - KSIYRRGARRWRKLYCANGHTFQ

AKRFNR RAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPP EPMMPMDQTMHPDHTQTV VIPYNPSSHESLDQVGEEKE AMNTR

ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDE DIDWVQTEKHVFEQASNHPFLVGLHSCFQTESR RLFFVIEYVNG

GDLMFHMQRQRKLPEEHAR RFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCK EGLRPGDTTSTFCGTPNYIAPEILRGEDYG - 

UNI17995 - GFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQV VILEKQIRIPRSLSVKAASVLKSFLNK DPKERLGCHPQTGFADI

QGHPFFRNVDWDM MEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDD DDIVRKIDQSEFEGFEYINPLLMSAEECV

For any suggestions or comments, please send an email to unitrap@crg.es