Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037646 (Vps13b)
Chromosomal location
Chr 15: 35301304 - 35859849 (+)
Description
vacuolar protein sorting 13B (yeast) Gene [Source:MGI Symbol;Acc:MGI:1916380]
MGI
MGI:1916380 
Uniprot/SWISSPROT
Q80TY5 
Uniprot/SPTREMBL
Q9D714 B2RY10 
Human Ortholog
ENSG00000132549 (VPS13B)
Omim 216550 - COHEN SYNDROME  
UniTrap UNI28458
Vector Insertion
Chr 15: 35301533 - 35301687
Public Clones not available
Private Clones OST30446 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28283
Vector Insertion
Chr 15: 35301863 - 35308643
Public Clones not available
Private Clones OST35156 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14859
Vector Insertion
Chr 15: 35308788 - 35347265
Public Clones PST4303-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25956
Vector Insertion
Chr 15: 35347387 - 35352062
Public Clones not available
Private Clones OST149236 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8273
Vector Insertion
Chr 15: 35353053 - 35359864
Public Clones RRF155 (baygenomics) IST14879G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9648
Vector Insertion
Chr 15: 35360040 - 35368467
Public Clones XG468 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16376
Vector Insertion
Chr 15: 35378477 - 35381852
Public Clones IST13042F2 (tigm) IST13042E2 (tigm)
Private Clones OST462018 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2643
Vector Insertion
Chr 15: 35401820 - 35463050
Public Clones DD0693 (sanger) YTC158 (baygenomics) CSE069 (baygenomics) YTC259 (baygenomics)
TEA113 (baygenomics) W082F02 (ggtc) W082E02 (ggtc) IST13353B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6117
Vector Insertion
Chr 15: 35464116 - 35501814
Public Clones YHD294 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8371
Vector Insertion
Chr 15: 35506282 - 35527149
Public Clones RRC278 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2984
Vector Insertion
Chr 15: 35527149 - 35527278
Public Clones AA0122 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9432
Vector Insertion
Chr 15: 35537120 - 35547352
Public Clones RRD222 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8011
Vector Insertion
Chr 15: 35547574 - 35553356
Public Clones RRI499 (baygenomics) RRK106 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3704
Vector Insertion
Chr 15: 35601181 - 35604563
Public Clones XT0521 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1949
Vector Insertion
Chr 15: 35604708 - 35638880
Public Clones CC0347 (sanger) AH0253 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12647
Vector Insertion
Chr 15: 35639569 - 35675401
Public Clones A028E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3346
Vector Insertion
Chr 15: 35723794 - 35724059
Public Clones AA0150 (sanger) YTA364 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4473
Vector Insertion
Chr 15: 35724245 - 35763938
Public Clones AA0046 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35405
Vector Insertion
Chr 15: 35817138 - 35835026
Public Clones IST14406G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32791
Vector Insertion
Chr 15: 35844706 - 35846801
Public Clones IST15082F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022887
Sequence
TCCATTGGAAGTGCCCCATTGGGAAAGCAGCAGTCATATCAGGCCTCAGAATATGCCAGCAGCCCAATCAAGACAAAAACAGTGACAG - UNI2984 -

 - UNI8371 - AGTCCAGACCAGTGTCAGTTCCTGTGAAGGCCGTGCTGCGTGTTCATGAAGAATGTAGAAGTCCTGAAGACAAAATGAAAGAATTTA

TCGCGATATTATGGAATGCAGTAAAGAGTCTCACGCTACAG - UNI2984 - CTTGATGTACAGTCTTGCTGTGTATTCATTCCAAATGACAACCTGC

CTTCCCCAAGTACAATTGTGTCTGGTGACATCCCTGGAACAGTAAGAAGTTGGTACCATGGACAAACCAGCATACCAGGGACACTTGTCCTGTGTTTGCC

GCAAATAAAGATTATTAGTGCTGGTCACAAGTACATGGAACCTCTGCAGGAGATTCCGTTTGTGATTCCCCGGCCCATCCTTGAAGAGG - UNI9432 

- GTGATGCATTTCCTTGGACCATAAGCTTGCATCATTTCAGCATATATACCCTTCTTGGAAAGCAAGTGACTCTTTCCCTTGTGGAGCCTATGGGATGT

ACCTCTACTCTAGCAGTCACATCTCAAAAGCTGCTTCCTGTGGGACCCGATGGAAGGCATTCATTTGTTGTCTGTCTTCATGTTGACTTAGAGTCATTAG

AGATAAAATGCTCTAATCCCCAG - UNI8011 - GTCCAGCTCATTTATGAATTGGCTGATACGATGAGTAAAGTCTGGAGTAAAATTCAGAAGAGAG

GCAATCTTAGTCCATCTTCAGTCTACCCAGAGACAGTGGCAGGGCCTATCCCTGGTTCTCCAGTTTGGAGCAGCGTAGGTACAGCTCCACCAGACACCAG

CACATGCAGCCCATCTGCTGACATAGGAACTACTACTGAG GGAGATTCGGTTCAAGCTGGTGATGATTCGCCATTCTCAGACTCTGTTACCTTGGAACA

AACTACCAGTAACATTGGTGGGTCCAGCGGCCGTGTTAGTCTGTGGATGCAGTGGGTGCTCCCCAAAGCTACTGTGAAGCTCTTTGCTCCAGACCTTGAA

AAAAAAGGCACAG AGGTCTGCATGGTCAGTGAACTGGAAGACCTCAGTGCATCCATAGACGTGCAGGATGTGTACACCAAAGTCAAGTGTAAGGTAGAG

AGTTTCAGTATCGACCACTATCAAAGCAG GCCTGGGGAAGGTTGGCAGTCAGGACATTTTGAAGGAGTGTTTCTGCAGTGCAAAGAAAAACCTGTG TT

ACCTCCATCTGTTATGATTTTACAGAAGAAAGTACAGAGGCCATATTGA
Translation
 - UNI2984 - - UNI8371 - MKEFIAILWNAVKSLTLQ - UNI2984 - LDVQSCCVFIPNDNLPSPSTIVSGDIPGTVRSWYHGQTSIPGTL

VLCLPQIKIISAGHKYMEPLQEIPFVIPRPILEEG - UNI9432 - GDAFPWTISLHHFSIYTLLGKQVTLSLVEPMGCTSTLAVTSQKLLPVGPDGR

HSFVVCLHVDLESLEIKCSNPQ - UNI8011 - VQLIYELADTMSKVWSKIQKRGNLSPSSVYPETVAGPIPGSPVWSSVGTAPPDTSTCSPSADIGT

TTE GDSVQAGDDSPFSDSVTLEQTTSNIGGSSGRVSLWMQWVLPKATVKLFAPDLEKKGTE EVCMVSELEDLSASIDVQDVYTKVKCKVESFSIDHYQ

SR RPGEGWQSGHFEGVFLQCKEKPV LPPSVMILQKKVQRPY
Transcript ENSMUST00000048646
Sequence
GGAAGAGCGCACGCCGCCGCTCTGTGGCGTGTTTACCTTGGAGCGGGTGCGGCGGCGGCGGCAGCAGCGGGCCTGACGCCAGCTCGGTCCTATGGCCGGA

GATCCGCCTGCGTTCCGGGAGTCGACCGCCTCTGGCTGGGCTGCGCTAGGGTAGGAGTGAAGCAGGACGTGCTGTCCTCCCACGCCCGGGGGCCGGCCGC

CTCCAGCCTCTCTGCCTACTCCTCGTCAG - UNI28458 - GATCTGACTTCGACGCTTAAATTTGAAGATGCTGGAGTCGTACGTAACTCCAATTTT

AATGAGTTATGTGAATCGCTATATCAAGAACTTAAAACCTTCAGATCTCCAGCTTTCACTATGGGGTGGGGACGTGGTTCTCAGCAAACTCGAGTTAAAG

TTGGACGTTCTGGAACAG - UNI28283 - GAACTGAAATTACCATTCACTTTTTTAAGTGGCCATATCCATGAACTGAGAATTCATGTACCATGGAC

AAAATTGGGCTCCGAACCTGTGGTAATTACCATCAATACAATGGAATGCATCTTGAAACTTAAAGATGGAATACAG - UNI14859 - GATGACCATG

AAAGCTGTGGTTCTAATTCTACCAACCGTAGCACTGCTGAGAACACAAAATCATCCATAAAACCCCGAAGAATTCAGCAGGCTGCTCCTGCAGACCCTGA

CTTACCACCAG - UNI25956 - GATATGTGCAGAGTCTGATTAGACGAGTTGTAAATAATGTAAACATTGTTATAAATAATCTCATACTAAAATATG

TTGAAGATGACATTGTTCTTTCTGTCAACATCACTTCTGCTGAATGCTATACCGTGGGTGAGTTATGGGATCGTGCATTCATGGATATTTCTG CAACTG

ATCTGGTGCTGAGGAAGGCTATCAATTTTTCTGACTGTACAGTTTGTCTCGATAAACGAAATGCTAGTGGCAAAATTGAATTTTACCAGGATCCTTTATT

GTACAAATGTTCTTTTAGAACTCGCCTGCATTTTACATATGATAACCTAAATTCCAAGATGCCATCTGTTATTAAA - UNI8273 - ATCCATACCTT

GGTAGAGAGTCTGAAGCTTTCTATCACAGACCAGCAGCTACCTATGTTTATCCGTATAATGCAGCTTGGGATTGCTCTGTATTATGGAGAAATAGGCAAC

TTTAAAGATGGTGAAACAGAAGACCCGCCCTGTCTCAGTAAAGATACACTAGCAAACCTTACAG - UNI9648 - GTACTGAGGAGGAAAGTAGAATA

GATATGCAGTATCCTGCTCCATACAAAGGCCAAGAGTTATATTCACAGGACTATGAGGAGCCTCAGGGATGGGTATCCTGGGCCTGGTCATTTGTTCCTG

CAATTGTGAGTTATGATGATGGTGAGGAAGACGACCTTGGGACTGACCCTGCATCAATCATGCATCAACAGAAAGCTCAAACGCTGAAGGATCCCATTGT

TTCTGTAGGCTTTTATTGCACAAAGGCGACTGTGACTTTTAAA CTCACTGAAATGCAAGCTGAAAATAGCTATTATAGCCCACAGAAAGTAAAATCTAA

GGAAGTTTTGTGTTGGGAACAAGAAGGAACTACAATTGAG GCTCTTATGATGGGAGAACCTTTCTTTGATTGTCAGATTGGATTTGTAGGTTGCAGAGC

CATGTGTCTGAAAGGAATTCTGGGTGTTAAAGATTTTGAGGAACATATGAATAGGAGTGAAACT GAAGCCTGCTTCTTCATTTGTGGTGAAAATTTGAG

TACAAAAGGTTTGACATACCTTACAAATTCATTGTTTGATTACCGGAGTCCAGAAAACAATGGTACCCGTGCAGAGTTTATCTTGGATGCAGCTCACCAT

AAG GAGACACACACTGACATAGCTGGCATACAGAGGTTTGGTGCGTTTTATATGGATTACCTGTATACAGTGGAGCACAGCAGTGGCAAAG GTCCAAC

AAGTCAACAAGACTTTCCTTCAGGGAAAAATGAGGATTTGGGAATAGTCCAAGAAAAGTCTACCAAGAGTCTTGTTATCGGGCCTCTAGATTGCCGTCTG

GACAGCAGTGCGGTGCATCGGGTTTTGAAGATGATTGTTTGTGCTCTGGAACATGAATATGAACCATATAGCAGGCTAAAACCAG - UNI16376 - A

AAGTAAGGATGAAAAGGAAACAGTACTGGATCCCGAGGAAGTGTCTTCTTTGGAGGAATATATCCCTACTCGGCATACAAGTGTTACTTTGCTTAAGTGC

ACTTGCACAGTTTTTATGGCAGAATTCAATTTACTTGATTGTTTGCTTCCTGTCATCATGGGAGGAAAG AACTCGAGTAACGTCACGAATGCCACAAAC

TTCCAGTCACTTCGGCCTTTGCCATCCATTCAGATATTGGTGGATAAAATTAATTTGGAACATTCTGTCCCAATGTATGCTGAACAGTTGGTCCATGTAG

TCAGCAGCCTTAATCAACCTTCTGATAATCTTCTTCATTATTGTTATGTCCACTGCTACCTTAAG GTGTTTGGTTTTCAGGCCGGACTGACTTGCTTGG

ATCATAGTGGCTCTTACTGCTTACCTGCACCAATTATCCCCTCTTTCAGCACAGCCCTTTATGGGAAGCTTCTGAAACTCCCTGCTCTCTG GACCAAAA

GATCTCAGACTGTTGTAACTGAGGGTATTTTTGAGCTCCCAAATCTCACAATTCAAGCTACAAGAGCACAGACACTTTTGTTGCAAGCAATATATCAGAG

TTGGTCTCATATTGGAAATGTCAGCTCTTCAACAGTAAATGAAGCTTTGATGAATGAAGTCTTCCCAATGACAG - UNI2643 - GTGTGAAATCTAA

GAATCCCCTGCCAACTCTTGAGGGCTCAATCCAGAATGTTGAACTGAAGTACTGCAGCACATCATTGGTCAAATGTGCCTCTGGGACCTTGGGATCCATA

AAAATTTGTGCCAAAGCCCCAG GTGACAGTGGAAAAGAGAAGTTGATCCCTTTGCTTCAGGGTCCTTCTGACACTAGAGACCTTCACAGTTCCAAGTGG

CTTAATGAAAGTAGAAAGCCCGAATCTCTCCTAGCTCCAGATTTGATAGCCTTTACCATCCAGGTCCCCCAGTACATGGACTACTGCCATCACTCTG - 

UNI6117 - GTGCTGTATTTCTTTGTAGTGTACAAGGACTCGCTGTTAACATTGACCCAATACTGTATACTTGGGTCATCTACCAACCACAGAAACGAG

CAAATAGACATGCACAACAG CAGCCTGTGGTAGCTGTACCTCTTGTCACTTCAGTTAACAGAAGGAAAGAAGATGAACTGTCCATTGGAAGTGCCCCAT

TGGGAAAGCAGCAGTCATATCAGGCCTCAGAATATGCCAGCAGCCCAATCAAGACAAAAACAGTGACAG - UNI2984 - - UNI8371 - AGTCCA

GACCAGTGTCAGTTCCTGTGAAGGCCGTGCTGCGTGTTCATGAAGAATGTAGAAGTCCTGAAGACAAAATGAAAGAATTTATCGCGATATTATGGAATGC

AGTAAAGAGTCTCACGCTACAG - UNI2984 - CTTGATGTACAGTCTTGCTGTGTATTCATTCCAAATGACAACCTGCCTTCCCCAAGTACAATTGT

GTCTGGTGACATCCCTGGAACAGTAAGAAGTTGGTACCATGGACAAACCAGCATACCAGGGACACTTGTCCTGTGTTTGCCGCAAATAAAGATTATTAGT

GCTGGTCACAAGTACATGGAACCTCTGCAGGAGATTCCGTTTGTGATTCCCCGGCCCATCCTTGAAGAGG - UNI9432 - GTGATGCATTTCCTTGG

ACCATAAGCTTGCATCATTTCAGCATATATACCCTTCTTGGAAAGCAAGTGACTCTTTCCCTTGTGGAGCCTATGGGATGTACCTCTACTCTAGCAGTCA

CATCTCAAAAGCTGCTTCCTGTGGGACCCGATGGAAGGCATTCATTTGTTGTCTGTCTTCATGTTGACTTAGAGTCATTAGAGATAAAATGCTCTAATCC

CCAG - UNI8011 - GTCCAGCTCATTTATGAATTGGCTGATACGATGAGTAAAGTCTGGAGTAAAATTCAGAAGAGAGGCAATCTTAGTCCATCTTC

AGTCTACCCAGAGACAGTGGCAGGGCCTATCCCTGGTTCTCCAGTTTGGAGCAGCGTAGGTACAGCTCCACCAGACACCAGCACATGCAGCCCATCTGCT

GACATAGGAACTACTACTGAG GGAGATTCGGTTCAAGCTGGTGATGATTCGCCATTCTCAGACTCTGTTACCTTGGAACAAACTACCAGTAACATTGGT

GGGTCCAGCGGCCGTGTTAGTCTGTGGATGCAGTGGGTGCTCCCCAAAGCTACTGTGAAGCTCTTTGCTCCAGACCTTGAAAAAAAAGGCACAG AGGTC

TGCATGGTCAGTGAACTGGAAGACCTCAGTGCATCCATAGACGTGCAGGATGTGTACACCAAAGTCAAGTGTAAGGTAGAGAGTTTCAGTATCGACCACT

ATCAAAGCAG CCTTGGAGAAGAGTGTTGGGGCACC GGAGGTGCCTTCCTTTCCTGTACTGAG CTGGACACTTGCACCTTGTTGGTTCGACCCCTTAG

CAAGCAGGACTCT AGTAACTGTCCTGCCTTCCTTTCTTCT ACAACTACAAAACTTCTAGATGGTGCTCATCAGCAGCATGGATTTCTTTCTCTGACAT

ACACCAAAGCTGTAACAAAAAATGTCCGCCACAAGTTAACCTCAAGAAATGAGCGAAGAAGCTTTTATAAGTTATCTGAAGGTTTAATGGATGGCTCGCC

TCATTTTCTTCATGAAATTCTTCTTTCTGCACAAGCGTTTGATATTGTTGTGTGCTTTCCTTTACTTAATGCAATTGCAAGTGTATTTCACACTAAACTC

CCAAAGACCCAAAGAGAGAAAAGAAAATCTTCAGGTCAGCCCATGAGGACCCATACGCTGACTTCACGCAATTTACCTTTGATTTATATCAATACAAGTG

TCATCAGAATTTTTGTTCCCCAAACAGAAGAAACACAGTCAACTGTTGCAG TGAATCAGGCAGCAAAGGAAGACACAATGGTTTTGAAGGTTGGCTCTA

TTGCCATGGCTCCTCAGGCTGATAATCCGCTTGGCAGATCTGTCCTCAGGAAAGATATTTACCA GAAAGCCTTAAACTTAGGAATTCTTCGAGATCCTG

GATCAGAAATTGAAGACAGACAGTACCAGATAGACCTGCAGTCCATCAATATCGGCACTGCTCAGTGGGATCAACTCAAACCAGAGAAAGGCAGTGGCTC

AGGAGGAGTGCCAACAGAGAGTGAGAGGAACTCTCAAAACCCAGCCCTGGAGTGGAACATGGCCAGCAG CATACAGCGTCATCAAGAAAGGAGAGCAAT

TTTGACACCCATCTTGACAGATTTTTCTGTGCGAATAACTGGAGCACCTGCCATCATTTTCACCAAAATAATCTCCCAAGAAAATCTGCATATGGAG - 

UNI3704 - GAGATTTTAGTGTGTGGCCATTCCTTGGAAGTGAACATAACCACAAACCTGGACTTCTTCCTAAGTGTGGCTCAGGTTCAACTCTTACAT

CAGTTAATAGTAGCAAATATGACTGGATTGGAGCCATCAACCAAGGCTACAGAG - UNI1949 - ATCTCTAAACAGGAACAGAAGAAAGTGGATACA

TTTGATGGAGGCACAGCTGAAACCTCTTCCCGATACAGTGGTGCTCAGGACAGTGGCATTGGCAGTGACAGTGTTAAAATCCGCATTGTGCAAATAGAGC

AGTACAGTGGTGCCAGTCAGCACCGCATTGCCCGGCCCTCTCACCAGTCGTCAATTGTGAAAAATCTTAATTTTATTCCCTTTGACATATTTATTACCGC

AAGTAGGATCTCCCTAATGACCTATTCCTCGGTGGCCTTACCCAAATTCAAATTACCAGAACAGAAAGAAGATGGGAAAACAGGCAGGACTTTCTTAAAT

CTCGCAGAAGTTGATTCTGATGTAGCTAAGCCTAACCAGGCGTGTGTTTCCATGGTGACTGCTGAAGATCCCTTAAGCAGTAGCACTTCTTTTTCCTCAG

GGAAAAAAGTAAGGGTTCTATCGCTTGAAAGCCTCCATGCATCCACAAGGTCATCTGCCAGACAAGCCCTCGGAGTCACTGTTGTTCGGCAGCCTGGCCG

AAGAGGAACCGGTGACTTAGAACTAGACCTGTTTCTCCATTTGATTGTGTCCCAGCCTTCCTTGCTTCTGAGTTGTCACCACAGGAAACAGAGAGTGGAA

GTATCCATCTTTGATGCTATGCTTAAAGGTGTACCCTCTGACTACACATGTACAG - UNI12647 - ATCCTGGGAAGACCCTGCCCGAAGCTTCTGA

CTATAACATCGTGTGGCTGCAGACTGTGCCTGGAGAAACAGACAGCAAAAGTGGGATCCCACCGTCTCTCGTCACACTACACATCAAAGACTTTCTTAAT

GGACCAG CTGACATCTACTTGGATGTATCAAAGCCTTTGAAAGCAAACTTAAGTTTTACCAAACTCGATCAGATAAATCATTTTTTAAAGAAGATAAAA

AAGGCACACAGCTCTGCACATAGCAAAGAGACCTCCACCCCGTCAGACTCTATACTGAATATGGATGAGCCTCCTGTCCCCAAATGTTACCGTGGAAAGT

TGTCAAAGACCAAAGTTCACTGTGATGAAGCACAGAAGACATCATTTCAAGAAAACATTTGGAGAGCCATCTCCTGCTTTCAAAAAGTTTCTGTCCATAC

TACCCAAATCGTGGTCTCCATGGAAACTGTCCCGCACCCTCATAAGCCATGTGTGTTAGCATCACTGTCAAACCTCAATGGAAGCCTTACTGTCAAAGCA

GCACAAAAAGTACCTG GCGCAAGCCTTGGATCATCATTCCTCCTCAGCATACATGATGTTCTCCTTAAAACAAGCCTCAAAGAAAGAAGTCGGATTCTT

ATAGGACCATTTTCTGCTACTGTCAATCTGGAAGCTAAATGGTGTAAACACAGTGGCAATCCAGGGCCACAACAGTCCATACCCAAAATATCCATGGATT

TAAGAGGTGGTTTGCTACAG GTTTTTTGGGGTCAAGAACATTTGAATTGCTTGGCTCTTCTGCATGAATTATTCAATGGGTATCTTCAGGAGGGAAAGT

CTGAAATGCCAGTACCCGAATCAGCACCCCAAATGCCATCTCCAGTGGAAAAGACTCAAGCTTTTAAAACTGAACAAAGTTCAGATGACCTGCGGACAGG

CATCTTTCAGTATGTACAGGACGCTG - UNI3346 - AATCTTTGAAACTCCCTGGTGTGTATGAAGTCTTGTTTTATAATGAAACAGAAGAGAGCCC

AGGGATGATGTTGTGGAGATATCCAGAACCTCGAGTGCTCACCCTTGTACGAATCACGCCTGTGCCTTTCAACACCACAGAGGATCCAGATATCAGCACA

GCAGACCTGGGTGATGTGCTGCAG - UNI4473 - GTCCCTTGTGGTTTGGAATATTGGGATGAACTCCAGAAGGTTTTTGTTGCGTTTCAAGAATTC

AGTCTGTCTGAAAGCAAAGTTTGTGAATTGCAGTTGCCAGATATCAACCTTGTACATGACCAGAAGAAACTGGTGTCCTCAGATCTGTGGAGAATCGTCC

TAAACAACAATCAAAATACGACAGATGACCAAAG TTCTGCAAGTGAATCCGGTTCTCAAAGCACTTGTGAACCACTTGTAACTCCAACAGCCCTGGCTG

CTTGCACCAGAGTGGACTCGTGTTTTACCCCATGGTTCGTCCCATCCCTGTGCATGTCCTTCCAGTTCGCTCATCTGGAATTCCGTCTTTGCCATCACCT

GGACCAACTAGGCACAG CTTCACCACAGTACCTACAGCCATTCATTTCTGATAAAAATGTGCCATCTGAACTGGAATACATGATCATTTCCTTCAGAGA

ACCAAACCTGCATCTTCGGCAGTGGAACAGTGGTCCTGTCTGCCAGGAGATCAAGTTCTCATCTCAGATGGATTGTAAACTTCTGGAATGCAGAAACGTC

ACGATGCAAACTGTGGTGAAACCCTTTGGCATCTGTGGACAGATGGCACTTTCCAGTGATGGCGTGCAGAAGCTGCTGGACTCCACCGTGATAGTGGACT

CTGTGCTTGTCAACTTCGGGCAGCATGTAGTTCATTCCTTAAACACTGCAATACAAGCGTGGCAACAG AACAAATGCCCTGAGGTAGAAGAGTTGGTCT

TCAGCCACTTTGTGATCTGTAATGACACACAGGAGACACTGCGGTTTGGCCAGGTGGATACTGATGAAAATATTCTTTTGGCGAGTCTCCACAGTCACCA

GTACAGCTGGCGTTCTCATAAATCCCCACAG CTGTTACACATCTGTATTGAAGGCTGGGGTAACTGGCGTTGGTCAGAGCCCTTCACTGTGGACCATGC

CGGTACATTTATTAGAACAATTCAGTACAAGGGTCGAACCGCTTCACTCATCATCAAAGTCCGAGCACTCAGTGGAGTGCAAAAACAG ATTATCATCTG

CGGAAGACAGATCATCTGTAGCTATTTGTCTCAGAGTATAGAACTGAAAGTTGTCCAGCATTACATTGGTCAAGATGGACAAGCTGTAGTTCGAGAACAC

TTTGATTGCCTCACAGCCAAACAGAAGTTGCCTTCGTACATATTAGAAAACAACGAACTGACAGAGCTGTGTGTGAAGGCTAAGGGAGACGAGGACTGGT

CAAGAGATGTGTGTCTGGAACCCAAAGCCTCTGAGTATAGCACTGTCATCCAG GTGCCTACTTCAAACAGTTCCATTATTTATGTGTGGTGCACAGTTT

TGACTTTGGAACCCAACTCTCAAGTTCAGCAGCGAATG ATCGTGTTCAGCCCTCTCTTTATCATGAGAAGTCATCTTCCAGACCCCATTATTATACATT

TGGAAAAAAGAAGTCTGGGTCTGAGTGAAACACAGATTATTCCAGGAAGAGGGCAGGAAAATCCACTGCAAAATGTCGAACCTGACCTTGTACATCACCT

GACATTTCAAGCACG GGAAGAATATGACCCTTCCGATTGTGCGGTTCCCATATCAACAGCCCTCATTAAGCAAATAGCCACTAAGATACAGCCTGGAGG

CACAGTTAATGAGATGCTTGATGAGTTCTATGGGCCAGAAAAGTCCCAGGAGCCCACTTGGCCTTACAGTAACAAAGATTCTGACAG GAATGAGCAGCT

GAGTCAGTGGGATAGCCCAATGCGAGTCAAACTGTCAATCTGGAAACCATATGTTAGAACCCTGTTGATAGAACTGCTACCCTGGGCCCTGCTTATCAAT

CAGTCCAAGTGGGATCTCTGGCTGTTTGAAGGAGAGAAGATTGTTCTACAAGTTCCTGCTGGCAAAATTATTATTCCTCCTAATTTTCAG GAAGCTTTT

CAAATTGGAATTTACTGGGAAAATACAAACACTGTGCACAAGACATTAGCAATTAAACTGGTCCATAATCTGACATCTCCAAAGTGGAAAGATGGCGGGA

ATGGTGAGGTAGTGACACTGGATGAAGAAGCATTTGTTGATGCTGAAATCAGACTCGGAGCTTTCCCAGGACATCAGAAG CTGTGTCAGTTCTGCATCT

CCTCCATGGTGCAGCACGGCATACAAGTCATTCAGATTGAAGATAAGACTACAGTAATCAATAACACGCCATATCAGATAGTTTATAAGCCACACTTGGC

CATCTCTAACTCCTATTCTGGAAAGGAG CATTGTCATGTTCCAGACAGTGCTACTTTCAGCATTTGTCCAGGGGGCGAGCATCCTGCCGTGAGATCCAG

CTCCCTGCCTTGCTGGGACGTCACGCCTGCTGTGGGGTCGTCAGAGCTGGACACAGCCACGCTTCAGAAACAGATACTGCTGGGGTTTTCTCCTGTACCA

GGAGCCGACAGCGCTCAGTGCTGGAGCCTGCCAGCCATCATTGGAGGAGAGTTTCCCAGACAGAGTGTAGCAGTGCCCTTTGGAACTGGGAGGGAAAATG

GATTCTGCACCAG GGCAATAGCACTGACATATCAAGAGCACTTGGGAGTCACTTACATAACCCTCTCCGAAGACCCAAGTCCTCGAGTCGTTTTCCACA

ACAGATGCCCAGTACCGATGCTCATGAAGGAGAACATCAGAG ATATTCCAAAGTTTGATGTTTATTGCAAAAAAATTCCTCCGGAGAGTTCGGTTCATC

ATGAGCTATATCACCAGATTATCAGTTACCCAGACTGCAAGACCAAGGACTTACTTCCCAGCCTGTTTCTGAGAATAGACTCGATGGAAGAAATGACAGC

CGAGTGGAGTGACCCTGTGGACATCAATAGTCAGGGAACACAG - UNI35404 - GTTGTATTCCTCACTGGCTTTGGCTATGTGTATGTGGACATCG

CCCAACAGTGTGGCACAGTCTTTATCATTCTAGCCCCGGAAGGAAAAGCAGGACCCATATTTACCAGCACCAGCAG AGCTCTGGAGAGGATGGTCACTT

TCAGGATGTTCATCACCCAGTTGAGCCTGGCAGTGTCTGACGACCTCACACACCAGGCACCATCGGAACTGCTAAGGCTCACCCTGGACAATGTTTTCCT

CCACGTGTCTCCTGTGCCTGCTCTCCTCCCAGGGGAAGAGCCTCCCTCCAGCTTCTTCCAGCTTTACGGTGTGGAAGTCTACTGCGGAGACCTGCAGCTG

GACAACCAGCTTTATAACAAGTCTAATTTCCATTTTGCTGTCTTGGTCTGCCAAGGAGAGAGAACAGACCCTGCTCAGTATTCCAGGGTGCAGAGTCTCC

TGGTCTCCAGCAAAGCCTTGGAAGAATACAAGGAGAATTGCTTCATCAAACTTTGCCTCACTGTCTCTGAGGGGAAGGACATCCTCCTCGATGTCAGCGA

GTTCACCTTTGAACTGAAGCCAGCACGGCTGTATGTGGAGGACACCTTTGTTTACTACATCAAAACTTTGTTTGACACCTACCTTCCTCCCAGCAGGATG

TCTGGTCACCATGCACAGCTGTTCACAGGGCAGCAGGTGCTGCCTGTGCAGGTGACACAGCACGCCAAGGCATTGGTGAACGCAGTGAAGTTACGGAAGC

TGCTCATCCAGCCAGTGAACCTGCTCATCAGCATCCATGCCTCCCTGAAGCTGTACATAGCCTCCGACCACACCCCTCTCTCCTTCTCTGTGTTTGAAAG

AGGACCAGTGTTCACCACAGCAAGGCAGCTGGTGCACGCACTGGCCATGCACTATGCTGCTGGGGCTCTTTTCAGAGCAG GCTGGGTGGTGGGGTCTCT

GGAAATCCTCGGCAGCCCCGCCAGCTTAGTGAGAAGCATTGGGAATGGGATCTCGGACTTCTTCAGGCTTCCATATGAGGGATTGACCCGAGGCCCAGGA

GCCTTCGTGAGCGGAGTCTCCAGAGGGACCACATCATTCGTCAAGCACATTTCCAAAG - UNI32791 - GTGCCTTGACATCCATCACCAACTTGGC

CACCAGCCTGGCCCGGAATATGGGCCGGCTCTCGCTGGACGAGGAGCACTACAACCGGCAGGAGGAGTGGCGGCGGCAGCTCCCTGAGAGCCTAGGTGAA

GGACTGCGACAGGGCCTGTCCAGACTGGGCATCAGCCTGCTCG GTGCAATTGCTGGGATAGTTGATCAGCCAATGCAGAACTTTCAGAAAACATCTGAG

ACCCAGGCTTCAGCAGGACATAAGGCCAAAGGTGTCATCTCAGGCGTGGGGAAAGGAATCATGGGGGTATTCACCAAACCCATTGGGGGAGCTGCAGAAC

TTGTGTCACAGACTGGCTACG GTATTTTACATGGAGCTGGACTTTCTCAGCTTCCCAAACAACGGTGCCAACCAACACATCTATATGCTGACCAGGCTC

CAAACAGCCACGTCAAATATGTCTG GAAAATGCTTCAGTCTTTGGGTAGACCAGAAGTCCACATGGCCTTGGATGTGGTTCTGGTGAGGGGTTCAGGCC

AAGAGCATGAAGGGTGCTTGCTGCTGACATCAGAAGTACTCTTTGTTGTAAGCATCAGTGAAGACACACAACAACAAGCCTTCCCCATCACAGAGATCAG

CTGTGCACAGGACACCAAGCAAAACAACCTACTCACTGTGCAGCTCAAGCAACCAAGAGTAGCCTCTGATGTGGAG ATTGATGGTGCCCGGGAGAGGCT

GTCAGAGCAACAGTTTAAGAGGCTCGTGGACTACATTGCAAAAACATCTTGTCACCTGGCCCCCAGCTGCTCTTCTATGCAGACATGTTCTGTGGTAGCT

GTGGAGCCTCCTCCTGCCACTGTTAAAACATACCATTATTTGGTGGACCCACATTTTGCTCAGGTCTTCATTAGTAAATTTACCATGGTAAAGAATAAAG

CCCTGAGGAAAGGCTTC
Translation
 - UNI28458 - MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQ - UNI28283 - ELKLPFTFLSGHIHELRIHVPWT

KLGSEPVVITINTMECILKLKDGIQ - UNI14859 - DDHESCGSNSTNRSTAENTKSSIKPRRIQQAAPADPDLPPG - UNI25956 - GYVQSL

IRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYTVGELWDRAFMDISA ATDLVLRKAINFSDCTVCLDKRNASGKIEFYQDPLLYKCSFRTRLHFT

YDNLNSKMPSVIK - UNI8273 - IHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKDGETEDPPCLSKDTLANLTG - UNI9648 - GT

EEESRIDMQYPAPYKGQELYSQDYEEPQGWVSWAWSFVPAIVSYDDGEEDDLGTDPASIMHQQKAQTLKDPIVSVGFYCTKATVTFK LTEMQAENSYYS

PQKVKSKEVLCWEQEGTTIE ALMMGEPFFDCQIGFVGCRAMCLKGILGVKDFEEHMNRSET EACFFICGENLSTKGLTYLTNSLFDYRSPENNGTRAE

FILDAAHHK ETHTDIAGIQRFGAFYMDYLYTVEHSSGKG GPTSQQDFPSGKNEDLGIVQEKSTKSLVIGPLDCRLDSSAVHRVLKMIVCALEHEYEPY

SRLKPE - UNI16376 - ESKDEKETVLDPEEVSSLEEYIPTRHTSVTLLKCTCTVFMAEFNLLDCLLPVIMGGK NSSNVTNATNFQSLRPLPSIQI

LVDKINLEHSVPMYAEQLVHVVSSLNQPSDNLLHYCYVHCYLK VFGFQAGLTCLDHSGSYCLPAPIIPSFSTALYGKLLKLPALW WTKRSQTVVTEGI

FELPNLTIQATRAQTLLLQAIYQSWSHIGNVSSSTVNEALMNEVFPMTG - UNI2643 - GVKSKNPLPTLEGSIQNVELKYCSTSLVKCASGTLGSI

KICAKAPG GDSGKEKLIPLLQGPSDTRDLHSSKWLNESRKPESLLAPDLIAFTIQVPQYMDYCHHSG - UNI6117 - GAVFLCSVQGLAVNIDPIL

YTWVIYQPQKRANRHAQQ QPVVAVPLVTSVNRRKEDELSIGSAPLGKQQSYQASEYASSPIKTKTVTE - UNI2984 - - UNI8371 - ESRPVS

VPVKAVLRVHEECRSPEDKMKEFIAILWNAVKSLTLQ - UNI2984 - LDVQSCCVFIPNDNLPSPSTIVSGDIPGTVRSWYHGQTSIPGTLVLCLPQ

IKIISAGHKYMEPLQEIPFVIPRPILEEG - UNI9432 - GDAFPWTISLHHFSIYTLLGKQVTLSLVEPMGCTSTLAVTSQKLLPVGPDGRHSFVVC

LHVDLESLEIKCSNPQ - UNI8011 - VQLIYELADTMSKVWSKIQKRGNLSPSSVYPETVAGPIPGSPVWSSVGTAPPDTSTCSPSADIGTTTE GD

SVQAGDDSPFSDSVTLEQTTSNIGGSSGRVSLWMQWVLPKATVKLFAPDLEKKGTE EVCMVSELEDLSASIDVQDVYTKVKCKVESFSIDHYQSS SLG

EECWGT GGAFLSCTE LDTCTLLVRPLSKQDS SNCPAFLSS TTTKLLDGAHQQHGFLSLTYTKAVTKNVRHKLTSRNERRSFYKLSEGLMDGSPHFL

HEILLSAQAFDIVVCFPLLNAIASVFHTKLPKTQREKRKSSGQPMRTHTLTSRNLPLIYINTSVIRIFVPQTEETQSTVAV VNQAAKEDTMVLKVGSIA

MAPQADNPLGRSVLRKDIYQ QKALNLGILRDPGSEIEDRQYQIDLQSINIGTAQWDQLKPEKGSGSGGVPTESERNSQNPALEWNMASS SIQRHQERR

AILTPILTDFSVRITGAPAIIFTKIISQENLHME - UNI3704 - EILVCGHSLEVNITTNLDFFLSVAQVQLLHQLIVANMTGLEPSTKATE - UN

I1949 - ISKQEQKKVDTFDGGTAETSSRYSGAQDSGIGSDSVKIRIVQIEQYSGASQHRIARPSHQSSIVKNLNFIPFDIFITASRISLMTYSSVALP

KFKLPEQKEDGKTGRTFLNLAEVDSDVAKPNQACVSMVTAEDPLSSSTSFSSGKKVRVLSLESLHASTRSSARQALGVTVVRQPGRRGTGDLELDLFLHL

IVSQPSLLLSCHHRKQRVEVSIFDAMLKGVPSDYTCTD - UNI12647 - DPGKTLPEASDYNIVWLQTVPGETDSKSGIPPSLVTLHIKDFLNGPA 

ADIYLDVSKPLKANLSFTKLDQINHFLKKIKKAHSSAHSKETSTPSDSILNMDEPPVPKCYRGKLSKTKVHCDEAQKTSFQENIWRAISCFQKVSVHTTQ

IVVSMETVPHPHKPCVLASLSNLNGSLTVKAAQKVPG GASLGSSFLLSIHDVLLKTSLKERSRILIGPFSATVNLEAKWCKHSGNPGPQQSIPKISMDL

RGGLLQ VFWGQEHLNCLALLHELFNGYLQEGKSEMPVPESAPQMPSPVEKTQAFKTEQSSDDLRTGIFQYVQDAE - UNI3346 - ESLKLPGVYEV

LFYNETEESPGMMLWRYPEPRVLTLVRITPVPFNTTEDPDISTADLGDVLQ - UNI4473 - VPCGLEYWDELQKVFVAFQEFSLSESKVCELQLPDI

NLVHDQKKLVSSDLWRIVLNNNQNTTDDQS SSASESGSQSTCEPLVTPTALAACTRVDSCFTPWFVPSLCMSFQFAHLEFRLCHHLDQLGTA ASPQYL

QPFISDKNVPSELEYMIISFREPNLHLRQWNSGPVCQEIKFSSQMDCKLLECRNVTMQTVVKPFGICGQMALSSDGVQKLLDSTVIVDSVLVNFGQHVVH

SLNTAIQAWQQ NKCPEVEELVFSHFVICNDTQETLRFGQVDTDENILLASLHSHQYSWRSHKSPQ LLHICIEGWGNWRWSEPFTVDHAGTFIRTIQYK

GRTASLIIKVRALSGVQKQ IIICGRQIICSYLSQSIELKVVQHYIGQDGQAVVREHFDCLTAKQKLPSYILENNELTELCVKAKGDEDWSRDVCLEPKA

SEYSTVIQ VPTSNSSIIYVWCTVLTLEPNSQVQQRM IVFSPLFIMRSHLPDPIIIHLEKRSLGLSETQIIPGRGQENPLQNVEPDLVHHLTFQAR RE

EYDPSDCAVPISTALIKQIATKIQPGGTVNEMLDEFYGPEKSQEPTWPYSNKDSDR RNEQLSQWDSPMRVKLSIWKPYVRTLLIELLPWALLINQSKWD

LWLFEGEKIVLQVPAGKIIIPPNFQ EAFQIGIYWENTNTVHKTLAIKLVHNLTSPKWKDGGNGEVVTLDEEAFVDAEIRLGAFPGHQK LCQFCISSMV

QHGIQVIQIEDKTTVINNTPYQIVYKPHLAISNSYSGKE HCHVPDSATFSICPGGEHPAVRSSSLPCWDVTPAVGSSELDTATLQKQILLGFSPVPGAD

SAQCWSLPAIIGGEFPRQSVAVPFGTGRENGFCTR RAIALTYQEHLGVTYITLSEDPSPRVVFHNRCPVPMLMKENIRD DIPKFDVYCKKIPPESSVH

HELYHQIISYPDCKTKDLLPSLFLRIDSMEEMTAEWSDPVDINSQGTQ - UNI35404 - VVFLTGFGYVYVDIAQQCGTVFIILAPEGKAGPIFTST

SR RALERMVTFRMFITQLSLAVSDDLTHQAPSELLRLTLDNVFLHVSPVPALLPGEEPPSSFFQLYGVEVYCGDLQLDNQLYNKSNFHFAVLVCQGERT

DPAQYSRVQSLLVSSKALEEYKENCFIKLCLTVSEGKDILLDVSEFTFELKPARLYVEDTFVYYIKTLFDTYLPPSRMSGHHAQLFTGQQVLPVQVTQHA

KALVNAVKLRKLLIQPVNLLISIHASLKLYIASDHTPLSFSVFERGPVFTTARQLVHALAMHYAAGALFRAG GWVVGSLEILGSPASLVRSIGNGISDF

FRLPYEGLTRGPGAFVSGVSRGTTSFVKHISKG - UNI32791 - GALTSITNLATSLARNMGRLSLDEEHYNRQEEWRRQLPESLGEGLRQGLSRLG

ISLLG GAIAGIVDQPMQNFQKTSETQASAGHKAKGVISGVGKGIMGVFTKPIGGAAELVSQTGYG GILHGAGLSQLPKQRCQPTHLYADQAPNSHVKY

VW WKMLQSLGRPEVHMALDVVLVRGSGQEHEGCLLLTSEVLFVVSISEDTQQQAFPITEISCAQDTKQNNLLTVQLKQPRVASDVE IDGARERLSEQQ

FKRLVDYIAKTSCHLAPSCSSMQTCSVVAVEPPPATVKTYHYLVDPHFAQVFISKFTMVKNKALRKGF

For any suggestions or comments, please send an email to unitrap@crg.es