Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037674 (Rfx7)
Chromosomal location
Chr 9: 72380047 - 72470744 (+)
Description
regulatory factor X, 7 Gene [Source:MGI Symbol;Acc:MGI:2442675]
RefSeq_dna
NM_001033536 
RefSeq_peptide
NP_001028708.1 
UniGene
Mm.32081 Mm.395799 
MGI
MGI:2442675 
Uniprot/SPTREMBL
Q3TDE2 Q3TSB6 Q8C1T6 Q8CB07 
Human Ortholog
ENSG00000181827 (RFX7)
Omim not available
UniTrap UNI9013
Vector Insertion
Chr 9: 72380788 - 72424845
Public Clones XF452 (baygenomics) (ggtc) IST11587B1 (tigm) IST14469B10 (tigm)
Private Clones OST396743 (lexicon) OST266635 (lexicon) OST60655 (lexicon) OST58491 (lexicon)
OST36158 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24881
Vector Insertion
Chr 9: 72439641 - 72441044
Public Clones not available
Private Clones OST202450 (lexicon) OST103473 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36202
Vector Insertion
Chr 9: 72441168 - 72455429
Public Clones IST11601E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8847
Vector Insertion
Chr 9: 72458196 - 72459427
Public Clones XM060 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6
Vector Insertion
Chr 9: 72459636 - 72462843
Public Clones GC0604 (tigem) GC0243 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093820
Sequence
GGGCTGCTCCGGGCTGGCAGGGCAGCAGTGGCCGCGGCGGCGGCGGGGCCGGGAGCGAGCGAGGGAGCGAGCGGCGTGGGGGAGCTCGGAGGCGCCAGGC

CCCCGGGGGAGGGCGGCCGGGGAGGCAGGCCCCCCGAGAGACCCGTCGGGTTGGATTTTGGGGCCGAGGGGGCGCCCGACCACGGACCTCGTTCTTCAGA

CGCCCCCCAGCCCCGGCCGCTGACGGGGGGCTGAGGGGCGCCGCCATGCCTCTGCCGCGGTGACGCGCGGGGCCGTAAGGAGAACCGGGAGAGGAACCGT

GACGAGAACCGCGAGGAGAACCGGGAGAGGAACCGTGACGAGAGCCGCGAGGAGCCGCGCGGTCTCCCCGGGGATGTCCCTCAGGCGGCCGGAGAAAGCG

ACTCACTCGAGCCCTGGGGTATAGGCCTAGCTTATCCAGCTTCCTTCCTTCCTCCTCTTCCTCCCCCTCCTCCTCCTCTTCCTCCCCTCCCCCTCCTCCT

CCCCTCGTCGTCCTCCCCTCCGCGTCTCTTCCCTCACCCTTCCCCGCGCCCCCATCTTCCCTCCCTCCCCTCCAGCAGCGATGGCAGAGGAACAACAACA

GCCGCCACCACAGCAGCTCGATGCCCCTCAGCAGCTTCCCCTCAGCGCCCCCAACCCCGGGGTGGCTCTGCCAGCCCTTGTGCCCGGGCTGCCAGGGACA

GAGGCCAACGCTCTGCAACACAAGATCAAGAACTCCATCTG - UNI9013 - CAAAACTGTACAATCTAAAGTGGACTGCATTTTG CAAGAAGTTGA

GAAGTTTACAGACCTAGAGAAACTCTACCTCTACCTTCAACTGCCTTCTGGTCTTAGCAGTGCAGAGAAAAG - UNI24881 - TGATCAGAATGCCA

TGTCATCTAGTCGGGCACAGCAAATGCATGCCTTTTCCTGGATTCGAAATACCTTAGAGGAGCATCCTGAGACGTCACTCCCCAAACAGGAAGTCTATGA

TGAATACAA - UNI36202 - GAGCTACTGCGACAATCTTGGCTACCATCCATTAAGTGCTGCTGACTTTGGAAAAATCATGAAAAACGTCTTTCCAA

ACATGAAGGCACGCCGTTTAGGCACTAGAGGCAAATCTAA ATATTGCTACAGTGGACTAAGGAAAAAAGCTTTTGTTCATATGCCAACACTGCCCAACC

TTGACTTTCATAAAACTGGAGATGGG - UNI8847 - TTGGAAGGAGTTGAACCATCTGGGCAGCTTCAAAATATTGATGAGGAAGTTATCTCTTCTG

CTTGCCGTCTTGTGTGTGAGTGGGCCCAGAAAGTGTTAAGCCAGCCATTTGACACAGTCTTGGAATTAGCCCACTTCCTTGTAAAGAGTCACTATATAGG

CACCAAGTCAATGGCAGCTCTGACTGTGATGGCGGCAGCACCGGCAG - UNI6 - GACTTAAAGGAATTCCCCAGCCTTCTGCTTTTATACCTACAGC

TGAAAGTAATTCCTTTCAACCTCAAGTAAAGACTTTGCCATCTCCAATTGATGCTAAGCAGCAGTTGCAACGGAAAATTCAAAAAAAGCAGCAAGAACAG

AAACTACAATCTCCATTGCCAGGAGAATCCTCAGCAAAAAAGCCAGAAGGCACTACAGCCAACGGAGTGGCTAATCTACCCAATGGGAACCCTGCGATCC

TTTCTCCCCAGCCCATTGGGATCGTGGTGGCAGCTGTCCCTAGCCCCATTCCG GTCCAGCGGACAAGGCAGTTAGTAACTTCACCAAGTCCAATGAATT

CTCCTGATGGCAAAGTTCTTCCCCTCAATGTGCAAGTGGTCACTCAGCACATGCAGTCTGTGAAACAGACACCAAAGACTCCTCAGAACGTTCCAGCCAG

TCCTGGTGGGGACCGTTCTGCCAGACACCGCTACCCTCAGATCTTACCCAAGCCAGCAAACACCAGTGCGCTCACCATCCGCTCTCCTACAACTGTGCTC

TTTACTAGCAGTCCCATCAAAACTGCTGTGGTACCTGCATCACACATGAGTTCTCTAAATGTGGTGAAAATGACAACAATATCCCTCACACCCAGTAACA

GTAATGCGCCTCTTAAACATTCTGCCTCAGTCAGCAGTGCTACTGGAACAACAGAGGAATCAAGGATTGTTCCTCAGATCAAGAATGGTTCTGTCGTTTC

TCTTCAGTCTCCTGGGTCCAGGGCTAGCAGCACTGGGGGAACTTCGGCTGTGGAAGTCAAAATGGAACCAGAAGGTTCATCAGATGAGCATCCTCTCCAG

TGCCAAGAGAACTCTGAGGAGACAAAAGCTCCCCTGACAACATCTAGTGCCCTTTGGGGCCAGAAAAGTAATACAGATGGAACAGTACCAAAACCTTCTA

ATGAAGGTGTCACTGAAGTGAAAACAACTAAGGTCTGTGACCAGAGGACCAAATGTAAAAATCGATGTAATGAAATTCTGTCAGGCATCTCAGCAGGCAA

TAATCAAAGCACTGTTACTCTCTCGGTTGCTACTCAGAACTTACCTTTCACCAGCACCAGCTCACCATCTAATGGTGACTCAGTAAATAAAGACCCTAAA

ATATGCACTAAAAGTCCAAGGAAACGACTGTCTGCTACATTGCAAGAGTCTCAGGTGCCTCCTGTAAAGAAACCAATTGTGGAACAGCTTTCTGCAGTTA

CTATAGAAGGTCAGAAACCAGGCACTGTTAAAAAGGACCAAAAGGTTCCACATTCAGGGAAAACAGAAAGTTCAACAGCAGGTGCTCAGATTCCTAACAA

GGTGTCAATCAGTGTCAGTTCACAGATAATAGAGGATCAGCCCGTGAACCCTGCTCTTGTCACCAGTGAACCAGTTCTGGAGCAGCAGACAACGCCATCA

TCGTCTCCGGATGTAAAAGTCAAACTTGAAGGGAGTGTCTTTCTCTTGGACCGTGAGTCAAAATCAGATGGCAGCTTTAATCGTAACGAATGGCAACAAG

TTACTAAGGATTCTGACTTCATAGCTGCCAGCTGTGAGCATCAGCAAGACATTAGTGTTATGACGATTGCTGAGCATCCTGACATCCATGATTTAGAGAA

ATCTGTTTGGGAATTAGAAGGGATGCCACAGGACACATACAGCCAGCAGCTACATAGCCAGATACCAGAATCTTCTCTGAATGAAATACAAGCACAGTCT

TCAGATCAGTTGCCATTGCAATCGGAACTGAAAGAGTTTGAGTCTTCTGTTTCCCAGACAAATGAAAGCTACTTTCCTTTTGACGATGAACTTACACAAG

ATAGCATTGTGGAAGAGCTGGTACTTATGGAGCAGCAGATGTCAATGAATAATTCACATTCTTATGGTAACTGCTTGGGAATGAGCCTTCAGAATCAGTC

AGTAACTCCAGGAGCTCCAATGTCATCTCATGCTTCCAGCACTCACTTCTATCATCCAATTCATAGCAATGGCACTCCAATTCACACACCTACACCCACA

CCCACTCCTACACCAACTCCAACCCCAACTCCAACCCCAACGTCTGAAATGATTGCTGGGTCTCAGAGTCTGTCACGGGAGAGCCCTTGTTCCAGGCTTG

CCCAGACAACACCTGTGGATAGTGCTTTAGGAAGTAGCCGACACACACCCATTGGTACTCCTCATTCTAATTGCAGCAGTAGCGTCCCTCCAAGCCCTGT

TGAATGCAGGAATCCATTTGCATTCACTCCAATAAGCTCCAGTATGGCATATCACGATGCCAGCATTGTCTCAAGCAGTCCTGTGAAACCAATGCAAAGA

CCCATGGCCACTCACCCTGATAAAACCAAGCTTGAATGGATGAATAATGGGTATGGTGGGGTTGGTAATTCATCGGTTTCTGGTCATGGCATTCTCCCAA

GCTATCAGGAACTAGTAGAAGATCGTTTCAGGAAACCTCATGCTTTTGCTGTACCTGGACAGTCATATCAGTCTCAGTCCAGACACCATGACACTCATTT

TGGTCGTTTGACTCCCGTCTCTCCTGTGCAGCATCAAGGTGCCACTGTAAACACCAACAAGCAAGAAGGGTTTGCAGTCCCAGCTCCTCTTGATAATAAG

GGAACTAATTCATCTGCCGGCAGCAACTTCAGGTGCCGGAGTGTGAGCCCTGCTGTCCATCGCCAACGGAATCTTAGTGGAAGCACCCTCTATCCTGTGT

CTAATATCCCACGGTCTAATGTAACCCCCTTTGGAAGTCCAGTGACCCCAGAAGTTCATGTTTTCACAAATGTTCACACAGATGCATGTGCCAACAACAT

AGCTCAAAGAAGTCAGTCAGTTCCATTGACAGTCATGATGCAAACAGCCTTCCCAAACGCTCTGCAGAAGCAAACAAACAGTAAAAAAATCACTAATGTT

TTGTTGAGTAAACTCGATTCTGACAATGATGATTCAGTGAGAGGTTTGGGAATTAACAACGTACCCTCCAATTACACAGCCCGGATGAATCTCACCCAGA

TTTTGGAAACTTCCCCTGTTTTTCCTAGTGCCAACTCACAAAATATGATCGATTCCAGCACTTCTGTTTATGAATTCCAAACACCATCTTACCTCACCAA

AAGTAATAGCACCGATCAGATCAGTTTTTCTCCTGGAGATAATCAAGCACAATCTGAAATTGGAGAACAGCAGTTAGATTTCAATAGCACTGTTAAAGAC

CTGTTGAGTGGAGACAACCTGCAAACCAGCCAGCAGCTGGTAGGTCAGGTGGCATCTGATCTCACCAACACTGCATCTGATTTCTCTAGCGACATCAGGT

TGTCTTCTGACCTCTCAGGCAGCATCAATGATTTGAACACCTTAGACCCAAATCTACTGTTTGATCCAGGTCGTCAGCAGGGACAGGATGATGAAGCCAC

ACTGGAAGAATTAAAGAATGACCCACTGTTTCAACAAATTTGCAGTGAGTCAATGAACTCTATGACTTCATCAGGTTTTGAATGGATAGAAAGCAAGGAC

CATCCTACTGTTGAAATGTTGGGATAAATTGTGTTTTATAATATGTAGCACACTGTATCTAAAGACATATGTATTGTATTTGTCTTAATGGAAGTGCCTC

CCGCAGCAGAAACACTATTAATTGTGACATTTTAAAAGCGTTTGCTGCAGAAGTGGTTTCTTCTTCAGTAGGAAATGGTTAGACTTGCCTCAGTTCTGGA

CACGTTTCTGAAGACAGTAGGCTGTAGAGCAAGTATTAGGTTTTAAATTTTATAATGTTCCCCATTTAATCACATTTGCTAGTAAAAAATCCAGATTTTT

ACGAGAGCAGTCTGGGTCTTTATTTTGTATAAGTTCATTTTAACTCATCAGTTGACCTACACAGAAATTAAAAGACCATCCATTTTTAGTTGTAGGCTGT

TTTGTTGTTGGCATTATCTTTTAGGTATGAAATCATAGCTAAGGTAAACTGTAGGCAAGAGAGTCTTCCTTAAAACAGGGATAATATTCAGGTTATTATA

AATATTTAAGCTTGAAACATAAAGCTACTGTAGGATGAAAAAATCTCTGTAGGACTTTCTGGGGCTTCGGTACCATTTACTCCCACAATGAAGGGCTTAT

GTAGGAGAAAATAATGGAAAATAAACATTAGTTTAAGGAAAGTAAAAGCTGCACTAAAATTTTTAAGAGGAAAACTAGTAGCCATTTATTTGTGACATTG

CATTAGTCCAATTTTAGAAGGTGGCTTTTAAAGTGGGGCTCTCCAGCTCATGCACTCTGGCTCTCTCCCCCATTTCCGTTCCCTTCCTATCTTCCCTCTT

CCTCTCTTCTTCCCTCCCCCCTCCCCATCTCTTACACGCACGCACACACACACACACATGACATTAAGATTTAATAGAAGAAATACAAGCATGTTAGGAA

GTTGTCTCGTGTTTTATTATTTGCTTGCTGAGATTGGAGTGTTAGAAGGAAAATAGAGGATTTTTTTTTAAGTTTCTTCACCACCGCTCCATGTACATAC

TGAAATTCTACTGAAGAATTCATTATTTTTTAATGCTTTTCACCATGGTATCCTTTAGTATTCAGCTTCCCTCCTCAGTTTGCTGACTAACTCCTTTGCT

TCTCTGAATGTAGTAATACAGTTCTATCATGGATCAAAACACCAAGCAGGAAAGAGATAACGTTAAAAGCCCAGCAAAAAAGCATTTCTTCACTTGAGGT

CTGAAGCCTCAGATCTTTCTATCTCTGATAACACAAAGGGGATGATATTAGTACTTGAAGAGAGGAGCATTTTATTACATGCTTGACTTATTTATTGTGA

TGGACACAGTTGCAAAAGAAGCAAAGCACTCAGGATTTGTTTTAAAGTGTTTCTCTGTGGCTCCCATTTTGTTTTATGAATAGTATTTATGAATCTCATG

TTAACACAAAACTAGTAGGCAGCTCCATTTAAGTGAGTTTCAAGGTAATTTTCAAAGAGATGTTAAAGTTAACCCTGAGTTTTAAAAGATTACATGAAAA

CATTCACTGTACTCTCCTGACTAGCCAAGCTTTTCTTTTACCTTAATTCAAAAAGAAATTAGAAGACTACAATCTGAATATTTAATAAATATGATAGAAG

GGTTAATTTAATAAGGGTCCATTGTTCAACAGATTTGAAAGTAGGGTATTAACATATTCTAATAAATCAATGGTGCTAGAGTTGGCTCAGAGGTTTATCT

ATGGATATGTCCTAGTTACTGGCATATGTGTGTGTTTGCTGTTAATTTGATTTAATGATTTGTTAGTTTTTTTTCTTGATAATAGTTATTTCTTCACTGT

ACATTGAGATACAGCACTACTGCACACCAAAGTATGTAATACCCAAAGGAAACTGTGTGATTTCTTCTAACAAATGATGGGAGCCTTTCTCAGTGAGATA

CTCTGAAAAGGAGACTTTGAGGCCATTCTAATCCCTTGTTTACATTGTTAGCTTCCTACTAATATAAAAATAATGGAAATCTTTTTTTGATAAAAAAAAA

AAAAGTCTAGAGACTGGAGGATTTTTACCCCCTGCCCCCTGTACAGTATTGCAGCAAACTCTTTAAATTTGGCTGAATTCGTCCAGCAAACTTTTTGGGG

TTCATATATTGCACTAAATTTGTTGAACCTGTGGTAGGCACATCTCTTAGGATAAATGCAACCAGTACAGTCCACAGATTAAAATTTTTAAATGTGTTTC

ATTATGAAAAGACAAAATATCATCAAAGTGACAGATGAAATTGTCTTATGTAGCAATGTGCACTGATCTCAATGAGATATTTCTATTTCTTATTCTCTTA

CACGAGAATATTACAGCAGGAAGAGTTAAGTTTAGTTTGCTTCACCATGTTAATACATGACCACAAAATGTGCATGAGTGTTCTTGACTTATCTTGTACA

GTACTAGGTAATCCTGTAACCACTTTTTTTCCCCTCTTGGCTGTATTGAAACTGGCTCTGTGTTAACCAGGTGAGCATAGTTATTCACAGGTTATTTTGC

TTTTTTAATGTTTACTAATTCTGCTTAGTTGTTGAATATGTTCTTTTCTTGGGATTTCTTTCATTGTTTTGACGTTTAAAACATTTTTGCATACTGTTTT

ATCATGATAAGACTTCATGAAGTAAATAATTTTGCATATAATTGCAATAAGCACTGACTTTTGAACTGAGAAAGAAGGAGCGTGGTTTGTGCAGTGCATC

TGAAGTTCAGATAACAGTCTTGTACTACAGTGTGCTTACTACACCAGAGGTGACAAAAGCAAGCCCTGTTGTGTGTTTCCTTTAGTGCAGAGTCAGACCC

TGGTGCTTTGTTGTCTGTTGTACCTGCTGAGATTACAGTAGTTGAGCATCGCACAGTAGCATTTCAGTTCTCTTTTTTTATTAAAAGTGCTCAAATTGTT

TTTTAAATGTTTTCAAAAACAATTAAAAACATTTTATATTATACTGACTGGATGTTAAGATAATTTATGGGATGTATTTTTATAGACAATTTGCCATTTT

ATAAATATGTACATGATGCTGTATTTTCCTTGAACTGGTGAAATGGGAGAGGGGC
Translation
MAEEQQQPPPQQLDAPQQLPLSAPNPGVALPALVPGLPGTEANALQHKIKNSIC - UNI9013 - CKTVQSKVDCIL QEVEKFTDLEKLYLYLQLPS

GLSSAEKS - UNI24881 - SDQNAMSSSRAQQMHAFSWIRNTLEEHPETSLPKQEVYDEYK - UNI36202 - KSYCDNLGYHPLSAADFGKIMK

NVFPNMKARRLGTRGKSK KYCYSGLRKKAFVHMPTLPNLDFHKTGDG - UNI8847 - LEGVEPSGQLQNIDEEVISSACRLVCEWAQKVLSQPFDT

VLELAHFLVKSHYIGTKSMAALTVMAAAPAG - UNI6 - GLKGIPQPSAFIPTAESNSFQPQVKTLPSPIDAKQQLQRKIQKKQQEQKLQSPLPGESS

AKKPEGTTANGVANLPNGNPAILSPQPIGIVVAAVPSPIP VQRTRQLVTSPSPMNSPDGKVLPLNVQVVTQHMQSVKQTPKTPQNVPASPGGDRSARHR

YPQILPKPANTSALTIRSPTTVLFTSSPIKTAVVPASHMSSLNVVKMTTISLTPSNSNAPLKHSASVSSATGTTEESRIVPQIKNGSVVSLQSPGSRASS

TGGTSAVEVKMEPEGSSDEHPLQCQENSEETKAPLTTSSALWGQKSNTDGTVPKPSNEGVTEVKTTKVCDQRTKCKNRCNEILSGISAGNNQSTVTLSVA

TQNLPFTSTSSPSNGDSVNKDPKICTKSPRKRLSATLQESQVPPVKKPIVEQLSAVTIEGQKPGTVKKDQKVPHSGKTESSTAGAQIPNKVSISVSSQII

EDQPVNPALVTSEPVLEQQTTPSSSPDVKVKLEGSVFLLDRESKSDGSFNRNEWQQVTKDSDFIAASCEHQQDISVMTIAEHPDIHDLEKSVWELEGMPQ

DTYSQQLHSQIPESSLNEIQAQSSDQLPLQSELKEFESSVSQTNESYFPFDDELTQDSIVEELVLMEQQMSMNNSHSYGNCLGMSLQNQSVTPGAPMSSH

ASSTHFYHPIHSNGTPIHTPTPTPTPTPTPTPTPTPTSEMIAGSQSLSRESPCSRLAQTTPVDSALGSSRHTPIGTPHSNCSSSVPPSPVECRNPFAFTP

ISSSMAYHDASIVSSSPVKPMQRPMATHPDKTKLEWMNNGYGGVGNSSVSGHGILPSYQELVEDRFRKPHAFAVPGQSYQSQSRHHDTHFGRLTPVSPVQ

HQGATVNTNKQEGFAVPAPLDNKGTNSSAGSNFRCRSVSPAVHRQRNLSGSTLYPVSNIPRSNVTPFGSPVTPEVHVFTNVHTDACANNIAQRSQSVPLT

VMMQTAFPNALQKQTNSKKITNVLLSKLDSDNDDSVRGLGINNVPSNYTARMNLTQILETSPVFPSANSQNMIDSSTSVYEFQTPSYLTKSNSTDQISFS

PGDNQAQSEIGEQQLDFNSTVKDLLSGDNLQTSQQLVGQVASDLTNTASDFSSDIRLSSDLSGSINDLNTLDPNLLFDPGRQQGQDDEATLEELKNDPLF

QQICSESMNSMTSSGFEWIESKDHPTVEMLG

For any suggestions or comments, please send an email to unitrap@crg.es