Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037683 (Armc3)
Chromosomal location
Chr 2: 19120745 - 19231861 (+)
Description
armadillo repeat containing 3 Gene [Source:MGI (curated);Acc:Armc3-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35294
Vector Insertion
Chr 2: 19222297 - 19225422
Public Clones IST12963C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049255
Sequence
GGAGGAGATTTTGAGCCTTGTTAGACTTGCCATGGCACGATTGTGGTTCCTGCAGGATTGATTGATCGATCACTTTGGAGCTGGACAAAGGGAGCCTTGG

GGCTAAGAACTAATTCCGGGCAGAGCACGCATGCGCAGCCCAGCGTCGCCTAGCAACAAACATCAACACAGACCCTCAGAGGCCAGTGGAGTTTGCCACA

TGTACAGAGCCACTGCTTCTTGAGACTTGACTCCGCGCAG GATGGGTAAAAAGATAAAGAAGGAAGTTGAACCTCCCCCTAAGGATGTG TTTGACCCA

ATCACAATTGAAAGCAAAAAGGCAGCCACTGTGGTGCTGATGCTCAAGTCTCCAGAGGAAGACATCTTAGCCAAAGCCTGCGAAGCCATCTATAAGTTTG

CTCTGAAAG GTGAGGAGAATAAAGCAACTCTCCTTGAACTTGGAGCTGTGGAGCCTTTGACCAAACTGCTCACCCACGAAGACAAAACTGTAAGAAGAA

ATGCTATGATGATCTTTGGTATTCTGGCTTCTAACA GTGATGTTAAGAAGCTCTTGAGGGAGTTAGAAGTTATGAATTCAGTGATTGCTCAGCTCTCCC

CAGAAG AAGAAGTTGTCATCCATGAGTTTGCTAGTCTTTGTCTTGCGAACATGTCCGTAGAGTACACAGGGAAAGTCCAGATATTTGAGCATGGTGGAC

TGGAGCCGCTCATCAGACTGCTGAGCAGCTCGGACCCGGACGTGAAGAAGAATTCTATTGAGTGCATCTACAACTTGGTACAG GATTTTCAGTGTCGGA

CTACACTTCAAGAGCTAAATGCAATCCCTCCGATATTAGAACTTTTGAGGTCAGAGTACCCCATTATCCAGCTGCTGGCTCTCAAAACCTTGGGTGTCAT

CACGTGCGATAAGGAGGCTCGGACGATGCTGAAGGAAAATCAAGGGCTGGACCACCTCACCAAGATCCTGGAGACCAAG GAACTGAATGACCTTCATGT

AGAAGCACTCTCAGTGATAGCCAACTGCCTGGAGGATATGGACACCATGGTGCTGATGCAGCAGACAGGGAGCCTCAAAAAAGTCCTGTCATTCGCAGAG

AGCTCCACAATTCCTGACATTCAGAAGAACGCAGCCAAAGCTATTGCCAAAGCAGCTTATGACC CTGAAAATAGAAAAGTTTTTCACGAACAAGAGGTT

GAAAAATGCCTGGTGACTCTCCTGGGATCTGACAGCGATGGAACCAAGATTGCTGCTTCCCAGGCTATTTCAGCCCTGTGTGAGAACTTGAGCTGCAAAG

AATTTTTCAACACCCAGG GGATTCCACAGATAGTTCAGTTGCTCAGAAGTGACAATGAGGAGGTGAGGGAAGCTGCCGCACTGGCCCTGGCAAACCTGA

CGACCAGCAGCCCTGCAAATGCCAA TGCTGCTGCAGAAGCAGATGCCATTGACCCGCTGATTAACATCCTGTCGAGCAAGCGGGATGGAGCCATTGCCA

ATGCTGCCACAGTGCTGACCAACATGGCCACGCAAGAGCCTCTGCGAGCTATCATCCAGAACCATGAAATAATGCACGCACTGTTGGGCCCCCTGCACTC

CACCAACACCTTGGTGCAGAGCACTGCAGCGCTCACCGTGGCTGCCACTGCCTGCGACGTGGAAGCCCGCACCCAG TTGAGGAACTGCGGTGGTCTGGT

GCCCCTGGTTGGGCTCCTGCACTCCAAGAATGACGAGGTACGAAGGCATGCCAGCTGGGCTGTGATGGTCTGTGCCGGCGATGAGCCGATGGCAGTTGAG

TTATGCAGGCTCGG GGCCCTAAATATCCTTGAAGAAATTAATCGATCATTAAGTCGGAAAAATAAATTCAGTGAGGCAGCCTATAACAAATTGCTAAAC

AACAATCTTTCCCTGAAATACAGCCAGACTGGCTATTTGTCATCAAGCAATATAATTAGCGATGGATTCTATGATTACGGTCGG ATAAATCCTGGCACC

AAACTTTTGTCACTGAAGGAACTGTGCTTACAGGAGCTGAATGATCAACGTGCTATTCTATTAGTCAACAATAAATCTGACAC CTCTCCACCTCCATCT

ATGGAGGATAAATCATCGGACGTTGGCTATGGACGAAGCATTTCTTCTTCATCTTCCTTAAGAAGGGGAAGCAAGGAGAAGGCCAA TTTTCGTTTTAGT

GCTATATTTGGATCTCCTACAGAAGAAAAATCCGAGCCAGCATCAGTACGGAACACTATCCTTAGCAGAGCTTTCACCAAAGAGAAGGGAGTAAG GAAA

GGGAAAGGGAAAAAAGAAGAAGAGAAAGTGAAAGAGGAAGAAGAGATCCTGGCACTGCCCAAGTTCACGGAAGGCAGCCCTGAGAAAGAGTGGAACCCTC

CTCCTGACCCTGAGTTCTGTGTGTATGTGCTGGAGGTGACCAAGTCGATACTGCCCATTGTCAACCTTAAGGAGCAGATTGAGGTCCTTGCCAA - UNI

35294 - GTATGTGGCAGATAAAATGGGCGGTAAGATTCCAAAAGAGAAGCTAGCTGATTTCAGCTGGGAACTTCATATAAGTGAGTTGAAATTTCAAC

TGAAATCCAATGTCGTACCAATTGGATACATCAAGAAGGGAATCTTTTATCATCGAGCGTTGCTTTTCAAG GCACTGGCTGATAAAATCGGGGTAGGCT

GCAGCCTGGTGCGTGGTGAGTACAGCCGAGGGTGGAACGAAGTGAAGCTGGTGAATGAGGCTCGGAAAGGCATGATCGGGAACCTGCCCCCACCCGAAGA

GTACATCGTGGATCTCATGTTCCACCCGGGGAACCTGCTGAAGCTGCGCAGCAAAGAGGCTGACCTCTACCGCTTTCTGTAGTCGCCAGAGGAACACAAG

ATCACCCAAGCCAGAAATTGTCTTCGCGTGTTTTCTAAGAGGGGCTTTAGCCGATTGGATAATTTCAAATAAAAGTATTAGAAAATGGTA
Translation
 MGKKIKKEVEPPPKDV FDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKG GEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILAS

NS SDVKKLLRELEVMNSVIAQLSPEE EEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQ DFQCRTTLQELN

AIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETK ELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSFAESSTIPD

IQKNAAKAIAKAAYDP PENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSCKEFFNTQG GIPQIVQLLRSDNEEVREAAALALANLTTS

SPANAN NAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQ LRNCGGLV

PLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLG GALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYGR INP

GTKLLSLKELCLQELNDQRAILLVNNKSDT TSPPPSMEDKSSDVGYGRSISSSSSLRRGSKEKAN NFRFSAIFGSPTEEKSEPASVRNTILSRAFTKE

KGVR RKGKGKKEEEKVKEEEEILALPKFTEGSPEKEWNPPPDPEFCVYVLEVTKSILPIVNLKEQIEVLAK - UNI35294 - KYVADKMGGKIPKE

KLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFK ALADKIGVGCSLVRGEYSRGWNEVKLVNEARKGMIGNLPPPEEYIVDLMFHPGNLLKL

RSKEADLYRFL
Transcript ENSMUST00000114640
Sequence
GGAGGAGATTTTGAGCCTTGTTAGACTTGCCATGGCACGATTGTGGTTCCTGCAGGATTGATTGATCGATCACTTTGGAGCTGGACAAAGGGAGCCTTGG

GGCTAAGAACTAATTCCGGGCAGAGCACGCATGCGCAGCCCAGCGTCGCCTAGCAACAAACATCAACACAGACCCTCAGAGGCCAGTGGAGTTTGCCACA

TGTACAGAGCCACTGCTTCTTGAGACTTGACTCCGCGCAG GATGGGTAAAAAGATAAAGAAGGAAGTTGAACCTCCCCCTAAGGATGTG TTTGACCCA

ATCACAATTGAAAGCAAAAAGGCAGCCACTGTGGTGCTGATGCTCAAGTCTCCAGAGGAAGACATCTTAGCCAAAGCCTGCGAAGCCATCTATAAGTTTG

CTCTGAAAG GTGAGGAGAATAAAGCAACTCTCCTTGAACTTGGAGCTGTGGAGCCTTTGACCAAACTGCTCACCCACGAAGACAAAACTGTAAGAAGAA

ATGCTATGATGATCTTTGGTATTCTGGCTTCTAACA GTGATGTTAAGAAGCTCTTGAGGGAGTTAGAAGTTATGAATTCAGTGATTGCTCAGCTCTCCC

CAGAAG AAGAAGTTGTCATCCATGAGTTTGCTAGTCTTTGTCTTGCGAACATGTCCGTAGAGTACACAGGGAAAGTCCAGATATTTGAGCATGGTGGAC

TGGAGCCGCTCATCAGACTGCTGAGCAGCTCGGACCCGGACGTGAAGAAGAATTCTATTGAGTGCATCTACAACTTGGTACAG GATTTTCAGTGTCGGA

CTACACTTCAAGAGCTAAATGCAATCCCTCCGATATTAGAACTTTTGAGGTCAGAGTACCCCATTATCCAGCTGCTGGCTCTCAAAACCTTGGGTGTCAT

CACGTGCGATAAGGAGGCTCGGACGATGCTGAAGGAAAATCAAGGGCTGGACCACCTCACCAAGATCCTGGAGACCAAG GAACTGAATGACCTTCATGT

AGAAGCACTCTCAGTGATAGCCAACTGCCTGGAGGATATGGACACCATGGTGCTGATGCAGCAGACAGGGAGCCTCAAAAAAGTCCTGTCATTCGCAGAG

AGCTCCACAATTCCTGACATTCAGAAGAACGCAGCCAAAGCTATTGCCAAAGCAGCTTATGACC CTGAAAATAGAAAAGTTTTTCACGAACAAGAGGTT

GAAAAATGCCTGGTGACTCTCCTGGGATCTGACAGCGATGGAACCAAGATTGCTGCTTCCCAGGCTATTTCAGCCCTGTGTGAGAACTTGAGCTGCAAAG

AATTTTTCAACACCCAGG GGATTCCACAGATAGTTCAGTTGCTCAGAAGTGACAATGAGGAGGTGAGGGAAGCTGCCGCACTGGCCCTGGCAAACCTGA

CGACCAGCAGCCCTGCAAATGCCAA TGCTGCTGCAGAAGCAGATGCCATTGACCCGCTGATTAACATCCTGTCGAGCAAGCGGGATGGAGCCATTGCCA

ATGCTGCCACAGTGCTGACCAACATGGCCACGCAAGAGCCTCTGCGAGCTATCATCCAGAACCATGAAATAATGCACGCACTGTTGGGCCCCCTGCACTC

CACCAACACCTTGGTGCAGAGCACTGCAGCGCTCACCGTGGCTGCCACTGCCTGCGACGTGGAAGCCCGCACCCAG TTGAGGAACTGCGGTGGTCTGGT

GCCCCTGGTTGGGCTCCTGCACTCCAAGAATGACGAGGTACGAAGGCATGCCAGCTGGGCTGTGATGGTCTGTGCCGGCGATGAGCCGATGGCAGTTGAG

TTATGCAGGCTCGG GGCCCTAAATATCCTTGAAGAAATTAATCGATCATTAAGTCGGAAAAATAAATTCAGTGAGGCAGCCTATAACAAATTGCTAAAC

AACAATCTTTCCCTGAAATACAGCCAGACTGGCTATTTGTCATCAAGCAATATAATTAGCGATGGATTCTATGATTACGGTCGG ATAAATCCTGGCACC

AAACTTTTGTCACTGAAGGAACTGTGCTTACAGGAGCTGAATGATCAACGTGCTATTCTATTAGTCAACAATAAATCTGACAC CTCTCCACCTCCATCT

ATGGAGGATAAATCATCGGACGTTGGCTATGGACGAAGCATTTCTTCTTCATCTTCCTTAAGAAGGGGAAGCAAGGAGAAGGCCAA TGCTATATTTGGA

TCTCCTACAGAAGAAAAATCCGAGCCAGCATCAGTACGGAACACTATCCTTAGCAGAGCTTTCACCAAAGAGAAGGGAGTAAG TAAAAAGAAAAGTAGA

CTTCAGTTGATTTGTTCCTCTTACCTTCTGTG GAAAGGGAAAGGGAAAAAAGAAGAAGAGAAAGTGAAAGAGGAAGAAGAGATCCTGGCACTGCCCAAG

TTCACGGAAGGCAGCCCTGAGAAAGAGTGGAACCCTCCTCCTGACCCTGAGTTCTGTGTGTATGTGCTGGAGGTGACCAAGTCGATACTGCCCATTGTCA

ACCTTAAGGAGCAGATTGAGGTCCTTGCCAA - UNI35294 - GTATGTGGCAGATAAAATGGGCGGTAAGATTCCAAAAGAGAAGCTAGCTGATTTC

AGCTGGGAACTTCATATAAGTGAGTTGAAATTTCAACTGAAATCCAATGTCGTACCAATTGGATACATCAAGAAGGGAATCTTTTATCATCGAGCGTTGC

TTTTCAAG GCACTGGCTGATAAAATCGGGGTAGGCTGCAGCCTGGTGCGTGGTGAGTACAGCCGAGGGTGGAACGAAGTGAAGCTGGTGAATGAGGCTC

GGAAAGGCATGATCGGGAACCTGCCCCCACCCGAAGAGTACATCGTGGATCTCATGTTCCACCCGGGGAACCTGCTGAAGCTGCGCAGCAAAGAGGCTGA

CCTCTACCGCTTTCTGTAGTCGCCAGAGGAACACAAGATCACCCAAGCCAGAAATTGTCTTCGCGTGTTTTCTAAGAGGGGCTTTAGCCGATTGGATAAT

TTCAAATAAAAGTATTAGAAAATGGTA
Translation
 MGKKIKKEVEPPPKDV FDPITIESKKAATVVLMLKSPEEDILAKACEAIYKFALKG GEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILAS

NS SDVKKLLRELEVMNSVIAQLSPEE EEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRLLSSSDPDVKKNSIECIYNLVQ DFQCRTTLQELN

AIPPILELLRSEYPIIQLLALKTLGVITCDKEARTMLKENQGLDHLTKILETK ELNDLHVEALSVIANCLEDMDTMVLMQQTGSLKKVLSFAESSTIPD

IQKNAAKAIAKAAYDP PENRKVFHEQEVEKCLVTLLGSDSDGTKIAASQAISALCENLSCKEFFNTQG GIPQIVQLLRSDNEEVREAAALALANLTTS

SPANAN NAAAEADAIDPLINILSSKRDGAIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQ LRNCGGLV

PLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLG GALNILEEINRSLSRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIISDGFYDYGR INP

GTKLLSLKELCLQELNDQRAILLVNNKSDT TSPPPSMEDKSSDVGYGRSISSSSSLRRGSKEKAN NAIFGSPTEEKSEPASVRNTILSRAFTKEKGVS

 SKKKSRLQLICSSYLLW WKGKGKKEEEKVKEEEEILALPKFTEGSPEKEWNPPPDPEFCVYVLEVTKSILPIVNLKEQIEVLAK - UNI35294 - 

KYVADKMGGKIPKEKLADFSWELHISELKFQLKSNVVPIGYIKKGIFYHRALLFK ALADKIGVGCSLVRGEYSRGWNEVKLVNEARKGMIGNLPPPEEY

IVDLMFHPGNLLKLRSKEADLYRFL

For any suggestions or comments, please send an email to unitrap@crg.es