Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037685 (Atp8a1)
Chromosomal location
Chr 5: 68009379 - 68238670 (-)
Description
ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 Gene [Source:MGI (curated);Acc:Atp8a1-001]
RefSeq_dna
NM_009727 NM_001038999 
RefSeq_peptide
NP_033857.1 NP_001034088.1 
UniGene
Mm.440990 Mm.153230 
MGI
MGI:1330848 
Uniprot/SWISSPROT
P70704 
Uniprot/SPTREMBL
Q1HCM7 Q3U9N5 A1L332 Q3TRP7 Q52KQ7 Q8CA15 Q5DTG0 Q8BR88 
Human Ortholog
ENSG00000124406 (ATP8A1)
Omim not available
UniTrap UNI16938
Vector Insertion
Chr 5: 68205963 - 68238400
Public Clones not available
Private Clones OST452140 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113651
Sequence
ACTGCGGGGAGACCTAGGCGGCTCTGCGGACGCAGCTCCTTCGCCGCCTTCCCCCTCCCGTCCAGTGCCCAGGCGGCTCCTGGCGGCGACGCTGCCCTGG

GTGGGAGGCGCGGCCCCGCGGCAGCTGAGCCCTCTGCGCGGCGCAGCCAGCTCTCCCGCCCGCGCGGCGCCGTGACAGGTGCAGGGTCCCCGCCCGAGAC

CCACCTGCAGGGGCTGTCGAGATGCCGACCATGCGGAGGACAGTGTCGGAGATCCGCTCGCGCGCGGAAG - UNI16938 - GTTATGAGAAGACAGA

TGATGTTTCAGAGAAGACCTCGCTGGCAGATCAGGAGGAAGTGAGAACCATCTTCATCAACCAGCCTCAGCTGACAAAATTCTGCAACAACCACGTCAG 

TACTGCAAAATACAACGTGATCACATTCCTTCCGAGGTTCCTCTATTCTCAGTTCCGAAGAGCGGCTAATTCGTTCTTTCTCTTTATTGCCCTGCTCCAG

 CAAATTCCTGATGTGTCGCCGACCGGTCGTTACACAACACTGGTTCCTCTCTTATTTATTTTAGCTGTGGCTGCTATTAAAGAGATAATAGAAGATATT

 TTTTGAGAAATGGTGCATGGGAAATTGTTCACTGGGAAAAG GTAAATGTTGGAGATATAGTTATAATAAAAGGCAAAGAGTATATACCTGCTGACACT

GTCCTTCTCTCGTCAAGGTAGAGACACCTACTGATGCTCAAACAGTGTAGAGGATGGTTTCTCTACCCTGCATTGACCTTGTGATTTCTCCAAGGAAATA

AAGAATAAACGAAGAATTTCAAAACC
Translation
MPTMRRTVSEIRSRAEG - UNI16938 - GYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVS STAKYNVITFLPRFLYSQFRRAANSFFLF

IALLQ QIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDI F 
Transcript ENSMUST00000113652
Sequence
ACTGCGGGGAGACCTAGGCGGCTCTGCGGACGCAGCTCCTTCGCCGCCTTCCCCCTCCCGTCCAGTGCCCAGGCGGCTCCTGGCGGCGACGCTGCCCTGG

GTGGGAGGCGCGGCCCCGCGGCAGCTGAGCCCTCTGCGCGGCGCAGCCAGCTCTCCCGCCCGCGCGGCGCCGTGACAGGTGCAGGGTCCCCGCCCGAGAC

CCACCTGCAGGGGCTGTCGAGATGCCGACCATGCGGAGGACAGTGTCGGAGATCCGCTCGCGCGCGGAAG - UNI16938 - GTTATGAGAAGACAGA

TGATGTTTCAGAGAAGACCTCGCTGGCAGATCAGGAGGAAGTGAGAACCATCTTCATCAACCAGCCTCAGCTGACAAAATTCTGCAACAACCACGTCAG 

TACTGCAAAATACAACGTGATCACATTCCTTCCGAGGTTCCTCTATTCTCAGTTCCGAAGAGCGGCTAATTCGTTCTTTCTCTTTATTGCCCTGCTCCAG

 CAAATTCCTGATGTGTCGCCGACCGGTCGTTACACAACACTGGTTCCTCTCTTATTTATTTTAGCTGTGGCTGCTATTAAAGAGATAATAGAAGATATT

 AAACGACACAAGGCTGATAATGCTGTGAACAAGAAACAGACACAAG TTTTGAGAAATGGTGCATGGGAAATTGTTCACTGGGAAAAG GTAAATGTTG

GAGATATAGTTATAATAAAAGGCAAAGAGTATATACCTGCTGACACTGTCCTTCTCTCGTCAAGGTAGAGACACCTACTGATGCTCAAACAGTGTAGAGG

ATGGTTTCTCTACCCTGCATTGACCTTGTGATTTCTCCAAGGAAATAAAGAATAAACGAAGAATTTCAAAACC
Translation
MPTMRRTVSEIRSRAEG - UNI16938 - GYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVS STAKYNVITFLPRFLYSQFRRAANSFFLF

IALLQ QIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDI KRHKADNAVNKKQTQV VLRNGAWEIVHWEK VNVGDIVIIKGKEYIPADTVLLSSR
Transcript ENSMUST00000113656
Sequence
ACTGCGGGGAGACCTAGGCGGCTCTGCGGACGCAGCTCCTTCGCCGCCTTCCCCCTCCCGTCCAGTGCCCAGGCGGCTCCTGGCGGCGACGCTGCCCTGG

GTGGGAGGCGCGGCCCCGCGGCAGCTGAGCCCTCTGCGCGGCGCAGCCAGCTCTCCCGCCCGCGCGGCGCCGTGACAGGTGCAGGGTCCCCGCCCGAGAC

CCACCTGCAGGGGCTGTCGAGATGCCGACCATGCGGAGGACAGTGTCGGAGATCCGCTCGCGCGCGGAAG - UNI16938 - GTTATGAGAAGACAGA

TGATGTTTCAGAGAAGACCTCGCTGGCAGATCAGGAGGAAGTGAGAACCATCTTCATCAACCAGCCTCAGCTGACAAAATTCTGCAACAACCACGTCAG 

TACTGCAAAATACAACGTGATCACATTCCTTCCGAGGTTCCTCTATTCTCAGTTCCGAAGAGCGGCTAATTCGTTCTTTCTCTTTATTGCCCTGCTCCAG

 CAAATTCCTGATGTGTCGCCGACCGGTCGTTACACAACACTGGTTCCTCTCTTATTTATTTTAGCTGTGGCTGCTATTAAAGAGATAATAGAAGATATT

 AAACGACACAAGGCTGATAATGCTGTGAACAAGAAACAGACACAAG TTTTGAGAAATGGTGCATGGGAAATTGTTCACTGGGAAAAG GTAAATGTTG

GAGATATAGTTATAATAAAAGGCAAAGAGTATATACCTGCTGACACTGTCCTTCTCTCGTCAAG TGAGCCCCAGGCCATGTGCTACATCGAGACATCCA

ACTTAGATGGTGAAACAAACTTGAAAATTAGACAA GGCTTACCGGCAACATCGGATATCAAAGACATTGACAGTTTGATGAGAATTTCTGGCAGAATCG

AGTGTGAAAGTCCAAACCGACATCTCTACGATTTTGTTGGGAACATAAGGCTTGATGGCCATGG CACCGTTCCCCTGGGGGCAGACCAGATCCTTCTCC

GAGGAGCTCAGTTAAGAAATACCCAGTGGGTTCATGGGATAGTTGTCTACACTGGCCACGACACCAAGCTGATGCAG AATTCCACAAGCCCACCACTTA

AACTCTCCAATGTGGAACGGATTACAAATGTACAAATTCTGATTTTATTTTGCATCTTAATTGCCATGTCTCTTGTGTGTTCTGTGGGCTCAGCCATTTG

GAACCGAAGGCATTCCGGGAAAGACTGGTACCTCCATCTACACT ATGGTGGCGCTAGTAACTTTGGACTGAACTTCCTGACTTTCATTATCCTTTTCAA

CAACCTCATTCCCATCAGCTTGCTGGTCACATTAGAAGTGGTGAAGTTTACTCAGGCATACTTCATAAATTGG GATCTTGACATGCATTATGAGCCCAC

AGACACCGCAGCAATGGCTCGGACATCTAATCTGAATGAGGAACTTGGCCAG GTTAAATACATATTTTCTGACAAAACTGGGACCCTGACATGCAATGT

GATGCAGTTCAAGAAGTGCACCATCGCGGGCGTGGCCTATGG CCATGTCCCTGAACCTGAGGATTATGGGTGCTCGCCCGATGAATG GCAGAGCTCAC

AGTTTGGAGATGAAAAAACCTTTAATGACCCGTCGTTGCTGGACAATCTCCAGAATAACCAC CCAACCGCACCTATCATCTGTGAATTTCTCACAATGA

TGGCCGTCTGCCACACAGCTGTACCGGAGAGAGAAGGGGACAAGATCATTTATCAGGCTGCATCGCCAG ATGAGGGTGCACTGGTCAGAGCCGCCAAGC

AGTTGAATTTTGTCTTCACTGGAAGAACTCCTGACTCTGTCATCATAGATTCA CTGGGGCAGGAAGAAAGATATGAATTGCTCAATGTCCTAGAGTTCA

CCAG TGCTAGGAAGAGGATGTCGGTGGTGGTTCGCACTCCATCCGGGAAGTTACGGCTCTACTGCAAAGGAGCT GACACAGTAATTTATGAACGACTT

GCAGAGACCTCAAAGTACAAAGAAATCACCCTAAAACACTTGGAACAGTTTGCTACAGAAG GGCTGAGGACTTTGTGTTTTGCTGTGGCTGAGATTTCT

GAGAGCGACTTCGAGGAGTGGCGGGCCGTCTACCACCGCGCATCCACGTCGGTACAGAACAGGCTGCTGAAGCTGGAGGAGAGCTACGAACTAATTGAAA

AG AATCTTCAGCTACTTGGAGCTACAGCCATTGAGGATAAATTGCAGGACCAAGTGCCTGAAACCATAGAAACGCTAATGAAGGCTGACATCAAAATAT

GGATCCTTACTGGGGACAAGCAAGAAACTGCCATTAATATTG GACACTCCTGTAGACTCCTCAAGAGGAACATGGGAATGATCGTGATAAACGAGGGCT

CTCTTGAC GGCACGAGGGAAACTCTCAGCCGCCACTGCACCACCCTGGGAGATGCTCTTCGGAAGGAAAATGATTTTGCTCTTATAATTGATGGGAAGA

CCCTCAAATATGCCTTAACCTTTGGCGTCCGGCAGTATTTCCTGGACTTAGCTCTGTCCTGCAAAGCTGTCATTTGCTGCAG GGTTTCTCCTCTTCAGA

AGTCCGAGGTTGTCGAGATGGTTAAGAAACAAGTCAAAGTCATCACACTTGCCATCGGGGATGGAGCAAATGACGTCAGCATGATCCAGACGGCCCATGT

GGGTGTTGGGATAAGCGGCAATGAAGGTTTGCAGGCAGCCAACTCTTCAGATTACTCCATCGCTCAG TTCAAATATTTGAAGAATTTGTTGATGGTTCA

CGGTGCCTGGAATTACAATAGAGTCTCCAAGTGTATCCTGTACTGCTTCTACAAGAACATCGTGCTCTACATCATCGAG ATCTGGTTTGCCTTTGTCAA

CGGCTTTTCTGGACAGATCCTCTTTGAAAGATGGTGTATAGGGCTTTATAATGTG ATGTTCACAGCGATGCCTCCCTTGACACTTGGAATATTTGAGAG

ATCGTGCAGAAAGGAGAACATGTTGAAGTATCCTGAGTTGTACAAAACATCCCAGAATGCTCTGGACTTCAATACCAAG GTTTTCTGGGTTCATTGTTT

GAATGGCCTCTTCCACTCCGTTATTCTGTTTTGGTTCCCACTGAAAGCCCTGCAGTATG GCACGGTATTTGGAAATGGGAAAACCTCAGATTACCTGCT

TCTGGGAAACTTTGTTTATACT TTTGTAGTGATAACTGTGTGCTTGAAAGCTGGACTGGAAACCTCCTATTGGACATGG TTCAGCCACATCGCCATCT

GGGGCAGCATCGCGCTCTGGGTGGTGTTCTTCGGGATCTACTCATCTCTGTGGCCTGCCGTGCCCATGGCCCCTGACATGTCCGGAGAG GCAGCCATGC

TCTTCAGCTCTGGAGTCTTCTGGGTGGGCTTGCTCTCCATCCCTGTGGCGTCCTTGCTTCTGGATGTGCTGTACAAAGT CATCAAGAGGACGGCCTTTA

AAACCTTAGTGGATGAAGTTCAGGAGCTTGAGGCGAAATCTCAAGACCCGGGCGCAGTCGTACTTGGAAAGAG CCTCACGGAGAGAGCGCAGCTGCTCA

AGAACGTCTTTAAGAAGAACCACGTGAATCTGTACCGCTCCGAGTCCCTGCAGCAGAACCTGCTTC ACGGCTATGCTTTCTCTCAAGATGAAAACGGCA

TCGTCTCACAGTCTGAAGTCATCAGAGCCTATGACACCACGAAACAGAGGCCCGATGAGTGGTGATTGGCAGGCCTAAGCCACCGGCCCCCCCGCTGTGT

CTCTGAGGAGAACCATCACAGTCTAAGGTCATCACTGTAACCTGCTGACCAATTCCAGTCTGGTCCATGGGGAGAAAAAGTGGATCTGAGCTCATCTCAC

AGATGAATTTCAAGGACATAGCGCTATGTGACTACTGTAATACCATTGTCCTTGGATGTCCTCAAAGTACCTGCTAAGGCTTTGTAAATCGATATTGGAA

ATTACCTTGTATCTTGCCACAGTGCTTTCTCAAAATGGGGACAGGTCAGTGTTCACAAGCCGTCCCTCTGGGGCTGTAACTATCGTTCATTGGCTCAACC

ACCAGTCAATCAACCATTCAAAAGAAACAACAACTCAGAAGTGATGTTAAGGGAAGGACTCTCAATATCCGGACTATCGGGATATACTGAAATAAGACAG

CTCACTCTACTGAGCATTTCTAAACAAGGCATTAACATGTGTTTGTGTCAAAGAGTGTCTTGCTAAGTGTTTGCCAAAGACGTTCAGTGTGTGCATTTCT

CATTCAGTAGTCATCTGCCCAGAAATTTAAAAGAAAGTTTATTTCATGGTATCTCTGTACCATCTGCATGCTTGACTTTTCAAACATGAGCGTGACTTAA

AATTTTGAGCATTTCCAGGCGTTTGCTACTAAAATCTGTGATGTTGCACCTTTGGCCTTACAACTGCTTTTCTGTCGTTTGTCTTCTTTTATTTGTTCCA

GTTGGAGGGACGTGTGTCCGTGTGACCGTTGTTATGATGCTGACTTTTTTTTTCCTTTTTTAATTGTACTGTCTCTCATTTCTGATGAACGTTAGACTCC

TTTAGATGTTCCTTTAAAAAAAAAAATCTGGCTTTTGCCGTGTATTGAGTGGCTACGTCTTCAGTCTTTCCCCTCCTAAGGAAATTACCCTTACATATTT

ATGTGGGATTTCCAAAGACCTTTGGGATAATCCGTGAGATAGTGCATGGGCTTTTTGTCATGTACATAGGCTCAGCTTTTGTCCTGTGCTGTTTGTTCTT

CACTGTGCGCTCCCACTGGCGATGATCTGTGCAGTACAGTTGGTCTCATGGCGACTACCCGTATGCTTAAGCCTGAAAATTATTTCACAGTTCACTCAGC

CGACAACTCCCAAACTGAGTTGCATACTGCTTATCGACACGAGAGAGATAAGGGGCACACTTCCCTCGTTTTAAGGAAATACCTATTTTACTCTAGCCTA

ACACCTCCCAGTCAATGAATACTTACCATCATAAGTAGGGTTCACTGATACGTTTTTCAAACATGTGTTCGCGCTGATCAGTTTGGCATCTCCATGAATT

CGCCTGAAAAAAAAAAAAAGCCTATTTTGCTACCTACAGTAAATGGTGAAGGGGCTGTTTAAAAACCACACCCAGTTTTCTACAGTTTTTATGGTATTTT

TTTCATCTTAAAAGATAAAAAAAAAGGGGGGAGTTCTAGTTTTCAGATACACTTCAGAGATCGAAACAAACTCTTCTGCCTTCTATTCAAAAGCCTGTTT

GCCTTTTTGTGGATTACCAGCAAAATAGACCTTCAAACGTGTGCAAGGACTAGCTTTGAGAAGGGGTGTTTTCTCCATATTACCCCATTAAATCATTTCA

TTTCCCCTTCCCCCCTTTTCTTGGTCTGAATTTAAAATTAGGCTGTGTCTTCCTTCTCTAAAGCTGTAGCTAGTTTCCATCGTGTCTCCATACTCCCTGC

AAAGAAGATAAGGTTCTAAAAATTCACGTAATTGGAAAGGGAGCACAGTGGACACACTTCACATCTCAAATGGTCCCGTTTGGAGCTTAGATCAGCCACA

CGAGCATCAAAGCATCTAGCAGAACCACACAACATAGAATCTAAGCTGATCTTCCAGACTGTGAGGCTGCAGGCTTAGCTGTCCACCAGCTGAATCTGGA

GAGTGGGTTGTTCTCAGCCTTCTGGGGGTGACCATTGAGGTCATTCCCCCCAAAATGACTGGTTATCCAAGAAAGGCTTGCTTCCCTTGGCCCCGCCATC

AGAGGTATCTGTCTCCAGATTCCTCGCCTCAGAACATTGTCAATGAGAATGGGATCTTCTGACCTCTGCCTGGAAATCTAAAGTCATCTTTTTATCCTGA

ATCATAAATTATTTTGATGGAACTCTTCCACATGAGCACACTCAGTTATACAACATACCCTGAAAACGAGACTCTATATGCCTTTTGACCATGGATCCTG

TGTTTGAATGACAGGCATTAATTTGGTCTCTCTGTTCTTAAGTTGGGAAGAACACAGAGAGTGGCCATTTGGGTAAAACTTGAAATAGGGACTTGCTATA

GCAGTGAGTTTACAGAGACTTAATACTCTCAAGTTTCTAACCTTTGTCAGCTGGGGAAAAGGCACATGGTTTTACCATGGATTTGAATGGGTGCAGTCAA

AGTGACTTTAAGCCTATGTTTTCTGAAATAAACAACACAGAACTCCAATTTAAAAGTCCCCTGTAGGGGACTCTGGTAAATGCTGACATGAGTGCTTTGT

AACGTTTACAATCCAGAAAAGCGGGGCGGTGAATCGTTGGTGTTGGGTTGGGATATCGCACAGTAGTGGAGAGCATAGACTTTCTGTGTGTTAGATATAC

ACCTAACAATTCACTGCTGTATCACGCCTATAAGATGCACTATTGGTGAAGGTATTAGCAGGAAAGCAGTGTTCTTGGGAACGTAGGCCTTTTAACATGG

TAAATGTGCCTCTTGGCTGGTTCTCCACTCAGTGCTCCCTGGGAGCCGGGAGAACTTGCTGGATTGCTTCTTTGTCACCCTGGCAAGTGAAGGGATACTG

CCAAATAAGGGAGCCACGGACTGTGTTGTCATTAAAGAGAGTCAGTGAGTTGGTTTCCTTTCCATCAGGAAAAATGGATTCTGTAAAGAGTCAGGGCGTT

GTCTCAGCATTTGATGATATATTTTAATTTTTCAGTTCAGTATCCCAGATAGCTGGTGTGATGCTCACAATAGGTTAGTCTGTTCTATACTCAGTGTCAC

ACTCATAACCTGTGATTGAAAGCTGCCCTTTCAGAAAACGAATGCTAGTCAGAAGGCAATGGGTTGGCGTCCTTTTTAATCAGTGTGTAACTATTATAAA

GCTACCTGTTCATCATACACTTGGTTTTTTTTTTTTTTCTGATGTTTCCTGGTCTTAAAACTTGTATCATAAAATGAATCTCTAGTCTAATAATTAAGCT

ACAAAATTTATTAAGGAAATGCCCCACTCATTCACACCATGGTGAGCAAGTATGTGGAGTCCCTTCTGTCTGTTGCTTACAATAACACTGTGTGGCTCCG

TGCCTCATAAATGCTTTGTAATTGTGAGTATTTCTGGATTGTTTCTTAAACATATCATAGTCTGATTTTTCTCACATTAAAATAAAACAACTTGTGAAAC

TTAGTTATACTTTGCTGTGTTTTAATTAACCTTCAGCAGTTATTAAAGTGGAATGTCAGTTAAATTTTAAGAAAAGGAGATAAATGCCTTCTGTGTTTCA

TATTGATTTATTTTGTGTAGGAGAGCAGCTGTTTGAGTTTTTTGGTGTGTGTGTGTTTGTTTTTGTTTTTTGTATTTTTTTGATAGGTTTATGGTTTGCA

TGAATTAGTATTTAAGGTGATTCAGACTAATGCATGGCTTTTGTATAAATCCTTATATTTATTTCTGTCTTATGAAACTTTACCATGACCTAAGAAGAAT

TAATGGGCAAATTAATCGGTCCTCCACATGACTTTCTTTTTTTTTTTTTTTTAACATAAATGGGTTGTTTTCCAAGTTTCAACCAATTCGGCTGAATCTT

TTTTATTTAATTGAATCTTCTGTTTAGCTTCCCTCCGAGAACTCTCCTTTAGAAAGTTCATGAAACTTCTCAGCAAATCAATCTTCCTTAAGTAGGAAGA

AAGGTGGCCTGGCCTGTACGCTCCCTTTGAATTAGCAGCAACTTTCCATCGGTAAGTATGCTCTGGTGGAGATGAGATTCTCAGTTGTAGACTAGAAGCC

ATAAATGCAGCGAGTGCTGCTTGCAGCACCCTCTGGCTCATTTCTTGCCTTTGCAAGTGTATGAAGTTAAAAGTAAGAAGGCAGCCTTAGAAGGCAGCTA

TGAAAAGCCGCCGTTCGCTTTAAAAAAATAGACATTCAGCTCCGTGGAAAAGCCATTCCCGCCGTAACGGCTGTAAAGATGGTGGCGCTGCATGCTGCGT

GGATAGTGTCTAATCTGTGCTTAAAGTGGTTCTCTCAGGTTTGTGTATCTTGATGCTTGATGCACTGTGTTTTATAAATAGTTACAAATGTTGAGTAAAA

ACCATTTCTATGCACTGTTCCGTGTCATTGGCCTTTTGTGAATGTGCATGTTTTAAACTGCAAATTTTAAACATTTTGTCCTAATTGTTATTAAAAAATA

AAATAAACTTTACCATTACATAAA
Translation
MRRTVSEIRSRAEG - UNI16938 - GYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVS STAKYNVITFLPRFLYSQFRRAANSFFLFIAL

LQ QIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDI KRHKADNAVNKKQTQV VLRNGAWEIVHWEK VNVGDIVIIKGKEYIPADTVLLSSS SEPQA

MCYIETSNLDGETNLKIRQ GLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHG GTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKL

MQ NSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHY YGGASNFGLNFLTFIILFNNLIPISLLVTLEVVKFTQAYF

INW DLDMHYEPTDTAAMARTSNLNEELGQ VKYIFSDKTGTLTCNVMQFKKCTIAGVAYG GHVPEPEDYGCSPDEW WQSSQFGDEKTFNDPSLLDNL

QNNH PTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPD DEGALVRAAKQLNFVFTGRTPDSVIIDS LGQEERYELLNVLEFTS SARKRMSVVVR

TPSGKLRLYCKGA DTVIYERLAETSKYKEITLKHLEQFATEG GLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEK NLQLLGAT

AIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIG GHSCRLLKRNMGMIVINEGSLD GTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALT

FGVRQYFLDLALSCKAVICCR RVSPLQKSEVVEMVKKQVKVITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQ FKYLKNLLMVHGAWN

YNRVSKCILYCFYKNIVLYIIE IWFAFVNGFSGQILFERWCIGLYNV MFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTK VFWVHCLNG

LFHSVILFWFPLKALQYG GTVFGNGKTSDYLLLGNFVYT FVVITVCLKAGLETSYWTW FSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGE AA

MLFSSGVFWVGLLSIPVASLLLDVLYKV VIKRTAFKTLVDEVQELEAKSQDPGAVVLGKS SLTERAQLLKNVFKKNHVNLYRSESLQQNLLH HGYAF

SQDENGIVSQSEVIRAYDTTKQRPDEW
Transcript ENSMUST00000072971
Sequence
ACTGCGGGGAGACCTAGGCGGCTCTGCGGACGCAGCTCCTTCGCCGCCTTCCCCCTCCCGTCCAGTGCCCAGGCGGCTCCTGGCGGCGACGCTGCCCTGG

GTGGGAGGCGCGGCCCCGCGGCAGCTGAGCCCTCTGCGCGGCGCAGCCAGCTCTCCCGCCCGCGCGGCGCCGTGACAGGTGCAGGGTCCCCGCCCGAGAC

CCACCTGCAGGGGCTGTCGAGATGCCGACCATGCGGAGGACAGTGTCGGAGATCCGCTCGCGCGCGGAAG - UNI16938 - GTTATGAGAAGACAGA

TGATGTTTCAGAGAAGACCTCGCTGGCAGATCAGGAGGAAGTGAGAACCATCTTCATCAACCAGCCTCAGCTGACAAAATTCTGCAACAACCACGTCAG 

TACTGCAAAATACAACGTGATCACATTCCTTCCGAGGTTCCTCTATTCTCAGTTCCGAAGAGCGGCTAATTCGTTCTTTCTCTTTATTGCCCTGCTCCAG

 CAAATTCCTGATGTGTCGCCGACCGGTCGTTACACAACACTGGTTCCTCTCTTATTTATTTTAGCTGTGGCTGCTATTAAAGAGATAATAGAAGATATT

 AAACGACACAAGGCTGATAATGCTGTGAACAAGAAACAGACACAAG TTTTGAGAAATGGTGCATGGGAAATTGTTCACTGGGAAAAG GTAAATGTTG

GAGATATAGTTATAATAAAAGGCAAAGAGTATATACCTGCTGACACTGTCCTTCTCTCGTCAAG TGAGCCCCAGGCCATGTGCTACATCGAGACATCCA

ACTTAGATGGTGAAACAAACTTGAAAATTAGACAA GGCTTACCGGCAACATCGGATATCAAAGACATTGACAGTTTGATGAGAATTTCTGGCAGAATCG

AGTGTGAAAGTCCAAACCGACATCTCTACGATTTTGTTGGGAACATAAGGCTTGATGGCCATGG CACCGTTCCCCTGGGGGCAGACCAGATCCTTCTCC

GAGGAGCTCAGTTAAGAAATACCCAGTGGGTTCATGGGATAGTTGTCTACACTGGCCACGACACCAAGCTGATGCAG AATTCCACAAGCCCACCACTTA

AACTCTCCAATGTGGAACGGATTACAAATGTACAAATTCTGATTTTATTTTGCATCTTAATTGCCATGTCTCTTGTGTGTTCTGTGGGCTCAGCCATTTG

GAACCGAAGGCATTCCGGGAAAGACTGGTACCTCCATCTACACT ATGGTGGCGCTAGTAACTTTGGACTGAACTTCCTGACTTTCATTATCCTTTTCAA

CAACCTCATTCCCATCAGCTTGCTGGTCACATTAGAAGTGGTGAAGTTTACTCAGGCATACTTCATAAATTGG GATCTTGACATGCATTATGAGCCCAC

AGACACCGCAGCAATGGCTCGGACATCTAATCTGAATGAGGAACTTGGCCAG GTTAAATACATATTTTCTGACAAAACTGGGACCCTGACATGCAATGT

GATGCAGTTCAAGAAGTGCACCATCGCGGGCGTGGCCTATGG GCAGAGCTCACAGTTTGGAGATGAAAAAACCTTTAATGACCCGTCGTTGCTGGACAA

TCTCCAGAATAACCAC CCAACCGCACCTATCATCTGTGAATTTCTCACAATGATGGCCGTCTGCCACACAGCTGTACCGGAGAGAGAAGGGGACAAGAT

CATTTATCAGGCTGCATCGCCAG ATGAGGGTGCACTGGTCAGAGCCGCCAAGCAGTTGAATTTTGTCTTCACTGGAAGAACTCCTGACTCTGTCATCAT

AGATTCA CTGGGGCAGGAAGAAAGATATGAATTGCTCAATGTCCTAGAGTTCACCAG TGCTAGGAAGAGGATGTCGGTGGTGGTTCGCACTCCATCCG

GGAAGTTACGGCTCTACTGCAAAGGAGCT GACACAGTAATTTATGAACGACTTGCAGAGACCTCAAAGTACAAAGAAATCACCCTAAAACACTTGGAAC

AGTTTGCTACAGAAG GGCTGAGGACTTTGTGTTTTGCTGTGGCTGAGATTTCTGAGAGCGACTTCGAGGAGTGGCGGGCCGTCTACCACCGCGCATCCA

CGTCGGTACAGAACAGGCTGCTGAAGCTGGAGGAGAGCTACGAACTAATTGAAAAG AATCTTCAGCTACTTGGAGCTACAGCCATTGAGGATAAATTGC

AGGACCAAGTGCCTGAAACCATAGAAACGCTAATGAAGGCTGACATCAAAATATGGATCCTTACTGGGGACAAGCAAGAAACTGCCATTAATATTG GAC

ACTCCTGTAGACTCCTCAAGAGGAACATGGGAATGATCGTGATAAACGAGGGCTCTCTTGAC GGCACGAGGGAAACTCTCAGCCGCCACTGCACCACCC

TGGGAGATGCTCTTCGGAAGGAAAATGATTTTGCTCTTATAATTGATGGGAAGACCCTCAAATATGCCTTAACCTTTGGCGTCCGGCAGTATTTCCTGGA

CTTAGCTCTGTCCTGCAAAGCTGTCATTTGCTGCAG GGTTTCTCCTCTTCAGAAGTCCGAGGTTGTCGAGATGGTTAAGAAACAAGTCAAAGTCATCAC

ACTTGCCATCGGGGATGGAGCAAATGACGTCAGCATGATCCAGACGGCCCATGTGGGTGTTGGGATAAGCGGCAATGAAGGTTTGCAGGCAGCCAACTCT

TCAGATTACTCCATCGCTCAG TTCAAATATTTGAAGAATTTGTTGATGGTTCACGGTGCCTGGAATTACAATAGAGTCTCCAAGTGTATCCTGTACTGC

TTCTACAAGAACATCGTGCTCTACATCATCGAG ATCTGGTTTGCCTTTGTCAACGGCTTTTCTGGACAGATCCTCTTTGAAAGATGGTGTATAGGGCTT

TATAATGTG ATGTTCACAGCGATGCCTCCCTTGACACTTGGAATATTTGAGAGATCGTGCAGAAAGGAGAACATGTTGAAGTATCCTGAGTTGTACAAA

ACATCCCAGAATGCTCTGGACTTCAATACCAAG GTTTTCTGGGTTCATTGTTTGAATGGCCTCTTCCACTCCGTTATTCTGTTTTGGTTCCCACTGAAA

GCCCTGCAGTATG GCACGGTATTTGGAAATGGGAAAACCTCAGATTACCTGCTTCTGGGAAACTTTGTTTATACT TTTGTAGTGATAACTGTGTGCTT

GAAAGCTGGACTGGAAACCTCCTATTGGACATGG TTCAGCCACATCGCCATCTGGGGCAGCATCGCGCTCTGGGTGGTGTTCTTCGGGATCTACTCATC

TCTGTGGCCTGCCGTGCCCATGGCCCCTGACATGTCCGGAGAG GCAGCCATGCTCTTCAGCTCTGGAGTCTTCTGGGTGGGCTTGCTCTCCATCCCTGT

GGCGTCCTTGCTTCTGGATGTGCTGTACAAAGT CATCAAGAGGACGGCCTTTAAAACCTTAGTGGATGAAGTTCAGGAGCTTGAGGCGAAATCTCAAGA

CCCGGGCGCAGTCGTACTTGGAAAGAG CCTCACGGAGAGAGCGCAGCTGCTCAAGAACGTCTTTAAGAAGAACCACGTGAATCTGTACCGCTCCGAGTC

CCTGCAGCAGAACCTGCTTC ACGGCTATGCTTTCTCTCAAGATGAAAACGGCATCGTCTCACAGTCTGAAGTCATCAGAGCCTATGACACCACGAAACA

GAGGCCCGATGAGTGGTGATTGGCAGGCCTAAGCCACCGGCCCCCCCGCTGTGTCTCTGAGGAGAACCATCACAGTCTAAGGTCATCACTGTAACCTGCT

GACCAATTCCAGTCTGGTCCATGGGGAGAAAAAGTGGATCTGAGCTCATCTCACAGATGAATTTCAAGGACATAGCGCTATGTGACTACTGTAATACCAT

TGTCCTTGGATGTCCTCAAAGTACCTGCTAAGGCTTTGTAAATCGATATTGGAAATTACCTTGTATCTTGCCACAGTGCTTTCTCAAAATGGGGACAGGT

CAGTGTTCACAAGCCGTCCCTCTGGGGCTGTAACTATCGTTCATTGGCTCAACCACCAGTCAATCAACCATTCAAAAGAAACAACAACTCAGAAGTGATG

TTAAGGGAAGGACTCTCAATATCCGGACTATCGGGATATACTGAAATAAGACAGCTCACTCTACTGAGCATTTCTAAACAAGGCATTAACATGTGTTTGT

GTCAAAGAGTGTCTTGCTAAGTGTTTGCCAAAGACGTTCAGTGTGTGCATTTCTCATTCAGTAGTCATCTGCCCAGAAATTTAAAAGAAAGTTTATTTCA

TGGTATCTCTGTACCATCTGCATGCTTGACTTTTCAAACATGAGCGTGACTTAAAATTTTGAGCATTTCCAGGCGTTTGCTACTAAAATCTGTGATGTTG

CACCTTTGGCCTTACAACTGCTTTTCTGTCGTTTGTCTTCTTTTATTTGTTCCAGTTGGAGGGACGTGTGTCCGTGTGACCGTTGTTATGATGCTGACTT

TTTTTTTCCTTTTTTAATTGTACTGTCTCTCATTTCTGATGAACGTTAGACTCCTTTAGATGTTCCTTTAAAAAAAAAAATCTGGCTTTTGCCGTGTATT

GAGTGGCTACGTCTTCAGTCTTTCCCCTCCTAAGGAAATTACCCTTACATATTTATGTGGGATTTCCAAAGACCTTTGGGATAATCCGTGAGATAGTGCA

TGGGCTTTTTGTCATGTACATAGGCTCAGCTTTTGTCCTGTGCTGTTTGTTCTTCACTGTGCGCTCCCACTGGCGATGATCTGTGCAGTACAGTTGGTCT

CATGGCGACTACCCGTATGCTTAAGCCTGAAAATTATTTCACAGTTCACTCAGCCGACAACTCCCAAACTGAGTTGCATACTGCTTATCGACACGAGAGA

GATAAGGGGCACACTTCCCTCGTTTTAAGGAAATACCTATTTTACTCTAGCCTAACACCTCCCAGTCAATGAATACTTACCATCATAAGTAGGGTTCACT

GATACGTTTTTCAAACATGTGTTCGCGCTGATCAGTTTGGCATCTCCATGAATTCGCCTGAAAAAAAAAAAAAGCCTATTTTGCTACCTACAGTAAATGG

TGAAGGGGCTGTTTAAAAACCACACCCAGTTTTCTACAGTTTTTATGGTATTTTTTTCATCTTAAAAGATAAAAAAAAAGGGGGGAGTTCTAGTTTTCAG

ATACACTTCAGAGATCGAAACAAACTCTTCTGCCTTCTATTCAAAAGCCTGTTTGCCTTTTTGTGGATTACCAGCAAAATAGACCTTCAAACGTGTGCAA

GGACTAGCTTTGAGAAGGGGTGTTTTCTCCATATTACCCCATTAAATCATTTCATTTCCCCTTCCCCCCTTTTCTTGGTCTGAATTTAAAATTAGGCTGT

GTCTTCCTTCTCTAAAGCTGTAGCTAGTTTCCATCGTGTCTCCATACTCCCTGCAAAGAAGATAAGGTTCTAAAAATTCACGTAATTGGAAAGGGAGCAC

AGTGGACACACTTCACATCTCAAATGGTCCCGTTTGGAGCTTAGATCAGCCACACGAGCATCAAAGCATCTAGCAGAACCACACAACATAGAATCTAAGC

TGATCTTCCAGACTGTGAGGCTGCAGGCTTAGCTGTCCACCAGCTGAATCTGGAGAGTGGGTTGTTCTCAGCCTTCTGGGGGTGACCATTGAGGTCATTC

CCCCCAAAATGACTGGTTATCCAAGAAAGGCTTGCTTCCCTTGGCCCCGCCATCAGAGGTATCTGTCTCCAGATTCCTCGCCTCAGAACATTGTCAATGA

GAATGGGATCTTCTGACCTCTGCCTGGAAATCTAAAGTCATCTTTTTATCCTGAATCATAAATTATTTTGATGGAACTCTTCCACATGAGCACACTCAGT

TATACAACATACCCTGAAAACGAGACTCTATATGCCTTTTGACCATGGATCCTGTGTTTGAATGACAGGCATTAATTTGGTCTCTCTGTTCTTAAGTTGG

GAAGAACACAGAGAGTGGCCATTTGGGTAAAACTTGAAATAGGGACTTGCTATAGCAGTGAGTTTACAGAGACTTAATACTCTCAAGTTTCTAACCTTTG

TCAGCTGGGGAAAAGGCACATGGTTTTACCATGGATTTGAATGGGTGCAGTCAAAGTGACTTTAAGCCTATGTTTTCTGAAATAAACAACACAGAACTCC

AATTTAAAAGTCCCCTGTAGGGGACTCTGGTAAATGCTGACATGAGTGCTTTGTAACGTTTACAATCCAGAAAAGCGGGGCGGTGAATCGTTGGTGTTGG

GTTGGGATATCGCACAGTAGTGGAGAGCATAGACTTTCTGTGTGTTAGATATACACCTAACAATTCACTGCTGTATCACGCCTATAAGATGCACTATTGG

TGAAGGTATTAGCAGGAAAGCAGTGTTCTTGGGAACGTAGGCCTTTTAACATGGTAAATGTGCCTCTTGGCTGGTTCTCCACTCAGTGCTCCCTGGGAGC

CGGGAGAACTTGCTGGATTGCTTCTTTGTCACCCTGGCAAGTGAAGGGATACTGCCAAATAAGGGAGCCACGGACTGTGTTGTCATTAAAGAGAGTCAGT

GAGTTGGTTTCCTTTCCATCAGGAAAAATGGATTCTGTAAAGAGTCAGGGCGTTGTCTCAGCATTTGATGATATATTTTAATTTTTCAGTTCAGTATCCC

AGATAGCTGGTGTGATGCTCACAATAGGTTAGTCTGTTCTATACTCAGTGTCACACTCATAACCTGTGATTGAAAGCTGCCCTTTCAGAAAACGAATGCT

AGTCAGAAGGCAATGGGTTGGCGTCCTTTTTAATCAGTGTGTAACTATTATAAAGCTACCTGTTCATCATACACTTGGTTTTTTTTTTTTTTCTGATGTT

TCCTGGTCTTAAAACTTGTATCATAAAATGAATCTCTAGTCTAATAATTAAGCTACAAAATTTATTAAGGAAATGCCCCACTCATTCACACCATGGTGAG

CAAGTATGTGGAGTCCCTTCTGTCTGTTGCTTACAATAACACTGTGTGGCTCCGTGCCTCATAAATGCTTTGTAATTGTGAGTATTTCTGGATTGTTTCT

TAAACATATCATAGTCTGATTTTTCTCACATTAAAATAAAACAACTTGTGAAACTTAGTTATACTTTGCTGTGTTTTAATTAACCTTCAGCAGTTATTAA

AGTGGAATGTCAGTTAAATTTTAAGAAAAGGAGATAAATGCCTTCTGTGTTTCATATTGATTTATTTTGTGTAGGAGAGCAGCTGTTTGAGTTTTTTGGT

GTGTGTGTGTTTGTTTTTGTTTTTTGTATTTTTTTGATAGGTTTATGGTTTGCATGAATTAGTATTTAAGGTGATTCAGACTAATGCATGGCTTTTGTAT

AAATCCTTATATTTATTTCTGTCTTATGAAACTTTACCATGACCTAAGAAGAATTAATGGGCAAATTAATCGGTCCTCCACATGACTTTCTTTTTTTTTT

TTTTTTAACATAAATGGGTTGTTTTCCAAGTTTCAACCAATTCGGCTGAATCTTTTTTATTTAATTGAATCTTCTGTTTAGCTTCCCTCCGAGAACTCTC

CTTTAGAAAGTTCATGAAACTTCTCAGCAAATCAATCTTCCTTAAGTAGGAAGAAAGGTGGCCTGGCCTGTACGCTCCCTTTGAATTAGCAGCAACTTTC

CATCGGTAAGTATGCTCTGGTGGAGATGAGATTCTCAGTTGTAGACTAGAAGCCATAAATGCAGCGAGTGCTGCTTGCAGCACCCTCTGGCTCATTTCTT

GCCTTTGCAAGTGTATGAAGTTAAAAGTAAGAAGGCAGCCTTAGAAGGCAGCTATGAAAAGCCGCCGTTCGCTTTAAAAAAATAGACATTCAGCTCCGTG

GAAAAGCCATTCCCGCCGTAACGGCTGTAAAGATGGTGGCGCTGCATGCTGCGTGGATAGTGTCTAATCTGTGCTTAAAGTGGTTCTCTCAGGTTTGTGT

ATCTTGATGCTTGATGCACTGTGTTTTATAAATAGTTACAAATGTTGAGTAAAAACCATTTCTATGCACTGTTCCGTGTCATTGGCCTTTTGTGAATGTG

CATGTTTTAAACTGCAAATTTTAAACATTTTGTCCTAATTGTTATTAAAAAATAAAATAAACTTTACCATTACATAAA
Translation
MPTMRRTVSEIRSRAEG - UNI16938 - GYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVS STAKYNVITFLPRFLYSQFRRAANSFFLF

IALLQ QIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDI KRHKADNAVNKKQTQV VLRNGAWEIVHWEK VNVGDIVIIKGKEYIPADTVLLSSS SE

PQAMCYIETSNLDGETNLKIRQ GLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHG GTVPLGADQILLRGAQLRNTQWVHGIVVYTGHD

TKLMQ NSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHY YGGASNFGLNFLTFIILFNNLIPISLLVTLEVVKFTQ

AYFINW DLDMHYEPTDTAAMARTSNLNEELGQ VKYIFSDKTGTLTCNVMQFKKCTIAGVAYG GQSSQFGDEKTFNDPSLLDNLQNNH PTAPIICEF

LTMMAVCHTAVPEREGDKIIYQAASPD DEGALVRAAKQLNFVFTGRTPDSVIIDS LGQEERYELLNVLEFTS SARKRMSVVVRTPSGKLRLYCKGA 

DTVIYERLAETSKYKEITLKHLEQFATEG GLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEK NLQLLGATAIEDKLQDQVPETI

ETLMKADIKIWILTGDKQETAINIG GHSCRLLKRNMGMIVINEGSLD GTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSC

KAVICCR RVSPLQKSEVVEMVKKQVKVITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQ FKYLKNLLMVHGAWNYNRVSKCILYCFYK

NIVLYIIE IWFAFVNGFSGQILFERWCIGLYNV MFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTK VFWVHCLNGLFHSVILFWFPLKA

LQYG GTVFGNGKTSDYLLLGNFVYT FVVITVCLKAGLETSYWTW FSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGE AAMLFSSGVFWVGLLS

IPVASLLLDVLYKV VIKRTAFKTLVDEVQELEAKSQDPGAVVLGKS SLTERAQLLKNVFKKNHVNLYRSESLQQNLLH HGYAFSQDENGIVSQSEVI

RAYDTTKQRPDEW
Transcript ENSMUST00000037380
Sequence
ACTGCGGGGAGACCTAGGCGGCTCTGCGGACGCAGCTCCTTCGCCGCCTTCCCCCTCCCGTCCAGTGCCCAGGCGGCTCCTGGCGGCGACGCTGCCCTGG

GTGGGAGGCGCGGCCCCGCGGCAGCTGAGCCCTCTGCGCGGCGCAGCCAGCTCTCCCGCCCGCGCGGCGCCGTGACAGGTGCAGGGTCCCCGCCCGAGAC

CCACCTGCAGGGGCTGTCGAGATGCCGACCATGCGGAGGACAGTGTCGGAGATCCGCTCGCGCGCGGAAG - UNI16938 - GTTATGAGAAGACAGA

TGATGTTTCAGAGAAGACCTCGCTGGCAGATCAGGAGGAAGTGAGAACCATCTTCATCAACCAGCCTCAGCTGACAAAATTCTGCAACAACCACGTCAG 

TACTGCAAAATACAACGTGATCACATTCCTTCCGAGGTTCCTCTATTCTCAGTTCCGAAGAGCGGCTAATTCGTTCTTTCTCTTTATTGCCCTGCTCCAG

 CAAATTCCTGATGTGTCGCCGACCGGTCGTTACACAACACTGGTTCCTCTCTTATTTATTTTAGCTGTGGCTGCTATTAAAGAGATAATAGAAGATATT

 AAACGACACAAGGCTGATAATGCTGTGAACAAGAAACAGACACAAG TTTTGAGAAATGGTGCATGGGAAATTGTTCACTGGGAAAAG GTGGCAGTGG

GGGAGATAGTGAAGGTGACCAATGGGGAACACCTCCCGGCAGATCTCCTCAGTCTGTCCTCAAG TGAGCCCCAGGCCATGTGCTACATCGAGACATCCA

ACTTAGATGGTGAAACAAACTTGAAAATTAGACAA GGCTTACCGGCAACATCGGATATCAAAGACATTGACAGTTTGATGAGAATTTCTGGCAGAATCG

AGTGTGAAAGTCCAAACCGACATCTCTACGATTTTGTTGGGAACATAAGGCTTGATGGCCATGG CACCGTTCCCCTGGGGGCAGACCAGATCCTTCTCC

GAGGAGCTCAGTTAAGAAATACCCAGTGGGTTCATGGGATAGTTGTCTACACTGGCCACGACACCAAGCTGATGCAG AATTCCACAAGCCCACCACTTA

AACTCTCCAATGTGGAACGGATTACAAATGTACAAATTCTGATTTTATTTTGCATCTTAATTGCCATGTCTCTTGTGTGTTCTGTGGGCTCAGCCATTTG

GAACCGAAGGCATTCCGGGAAAGACTGGTACCTCCATCTACACT ATGGTGGCGCTAGTAACTTTGGACTGAACTTCCTGACTTTCATTATCCTTTTCAA

CAACCTCATTCCCATCAGCTTGCTGGTCACATTAGAAGTGGTGAAGTTTACTCAGGCATACTTCATAAATTGG GATCTTGACATGCATTATGAGCCCAC

AGACACCGCAGCAATGGCTCGGACATCTAATCTGAATGAGGAACTTGGCCAG GTTAAATACATATTTTCTGACAAAACTGGGACCCTGACATGCAATGT

GATGCAGTTCAAGAAGTGCACCATCGCGGGCGTGGCCTATGG CCATGTCCCTGAACCTGAGGATTATGGGTGCTCGCCCGATGAATG GCAGAGCTCAC

AGTTTGGAGATGAAAAAACCTTTAATGACCCGTCGTTGCTGGACAATCTCCAGAATAACCAC CCAACCGCACCTATCATCTGTGAATTTCTCACAATGA

TGGCCGTCTGCCACACAGCTGTACCGGAGAGAGAAGGGGACAAGATCATTTATCAGGCTGCATCGCCAG ATGAGGGTGCACTGGTCAGAGCCGCCAAGC

AGTTGAATTTTGTCTTCACTGGAAGAACTCCTGACTCTGTCATCATAGATTCA CTGGGGCAGGAAGAAAGATATGAATTGCTCAATGTCCTAGAGTTCA

CCAG TGCTAGGAAGAGGATGTCGGTGGTGGTTCGCACTCCATCCGGGAAGTTACGGCTCTACTGCAAAGGAGCT GACACAGTAATTTATGAACGACTT

GCAGAGACCTCAAAGTACAAAGAAATCACCCTAAAACACTTGGAACAGTTTGCTACAGAAG GGCTGAGGACTTTGTGTTTTGCTGTGGCTGAGATTTCT

GAGAGCGACTTCGAGGAGTGGCGGGCCGTCTACCACCGCGCATCCACGTCGGTACAGAACAGGCTGCTGAAGCTGGAGGAGAGCTACGAACTAATTGAAA

AG AATCTTCAGCTACTTGGAGCTACAGCCATTGAGGATAAATTGCAGGACCAAGTGCCTGAAACCATAGAAACGCTAATGAAGGCTGACATCAAAATAT

GGATCCTTACTGGGGACAAGCAAGAAACTGCCATTAATATTG GACACTCCTGTAGACTCCTCAAGAGGAACATGGGAATGATCGTGATAAACGAGGGCT

CTCTTGAC GGCACGAGGGAAACTCTCAGCCGCCACTGCACCACCCTGGGAGATGCTCTTCGGAAGGAAAATGATTTTGCTCTTATAATTGATGGGAAGA

CCCTCAAATATGCCTTAACCTTTGGCGTCCGGCAGTATTTCCTGGACTTAGCTCTGTCCTGCAAAGCTGTCATTTGCTGCAG GGTTTCTCCTCTTCAGA

AGTCCGAGGTTGTCGAGATGGTTAAGAAACAAGTCAAAGTCATCACACTTGCCATCGGGGATGGAGCAAATGACGTCAGCATGATCCAGACGGCCCATGT

GGGTGTTGGGATAAGCGGCAATGAAGGTTTGCAGGCAGCCAACTCTTCAGATTACTCCATCGCTCAG TTCAAATATTTGAAGAATTTGTTGATGGTTCA

CGGTGCCTGGAATTACAATAGAGTCTCCAAGTGTATCCTGTACTGCTTCTACAAGAACATCGTGCTCTACATCATCGAG ATCTGGTTTGCCTTTGTCAA

CGGCTTTTCTGGACAGATCCTCTTTGAAAGATGGTGTATAGGGCTTTATAATGTG ATGTTCACAGCGATGCCTCCCTTGACACTTGGAATATTTGAGAG

ATCGTGCAGAAAGGAGAACATGTTGAAGTATCCTGAGTTGTACAAAACATCCCAGAATGCTCTGGACTTCAATACCAAG GTTTTCTGGGTTCATTGTTT

GAATGGCCTCTTCCACTCCGTTATTCTGTTTTGGTTCCCACTGAAAGCCCTGCAGTATG GCACGGTATTTGGAAATGGGAAAACCTCAGATTACCTGCT

TCTGGGAAACTTTGTTTATACT TTTGTAGTGATAACTGTGTGCTTGAAAGCTGGACTGGAAACCTCCTATTGGACATGG TTCAGCCACATCGCCATCT

GGGGCAGCATCGCGCTCTGGGTGGTGTTCTTCGGGATCTACTCATCTCTGTGGCCTGCCGTGCCCATGGCCCCTGACATGTCCGGAGAG GCAGCCATGC

TCTTCAGCTCTGGAGTCTTCTGGGTGGGCTTGCTCTCCATCCCTGTGGCGTCCTTGCTTCTGGATGTGCTGTACAAAGT CATCAAGAGGACGGCCTTTA

AAACCTTAGTGGATGAAGTTCAGGAGCTTGAGGCGAAATCTCAAGACCCGGGCGCAGTCGTACTTGGAAAGAG CCTCACGGAGAGAGCGCAGCTGCTCA

AGAACGTCTTTAAGAAGAACCACGTGAATCTGTACCGCTCCGAGTCCCTGCAGCAGAACCTGCTTC ACGGCTATGCTTTCTCTCAAGATGAAAACGGCA

TCGTCTCACAGTCTGAAGTCATCAGAGCCTATGACACCACGAAACAGAGGCCCGATGAGTGGTGATTGGCAGGCCTAAGCCACCGGCCCCCCCGCTGTGT

CTCTGAGGAGAACCATCACAGTCTAAGGTCATCACTGTAACCTGCTGACCAATTCCAGTCTGGTCCATGGGGAGAAAAAGTGGATCTGAGCTCATCTCAC

AGATGAATTTCAAGGACATAGCGCTATGTGACTACTGTAATACCATTGTCCTTGGATGTCCTCAAAGTACCTGCTAAGGCTTTGTAAATCGATATTGGAA

ATTACCTTGTATCTTGCCACAGTGCTTTCTCAAAATGGGGACAGGTCAGTGTTCACAAGCCGTCCCTCTGGGGCTGTAACTATCGTTCATTGGCTCAACC

ACCAGTCAATCAACCATTCAAAAGAAACAACAACTCAGAAGTGATGTTAAGGGAAGGACTCTCAATATCCGGACTATCGGGATATACTGAAATAAGACAG

CTCACTCTACTGAGCATTTCTAAACAAGGCATTAACATGTGTTTGTGTCAAAGAGTGTCTTGCTAAGTGTTTGCCAAAGACGTTCAGTGTGTGCATTTCT

CATTCAGTAGTCATCTGCCCAGAAATTTAAAAGAAAGTTTATTTCATGGTATCTCTGTACCATCTGCATGCTTGACTTTTCAAACATGAGCGTGACTTAA

AATTTTGAGCATTTCCAGGCGTTTGCTACTAAAATCTGTGATGTTGCACCTTTGGCCTTACAACTGCTTTTCTGTCGTTTGTCTTCTTTTATTTGTTCCA

GTTGGAGGGACGTGTGTCCGTGTGACCGTTGTTATGATGCTGACTTTTTTTTTCCTTTTTTAATTGTACTGTCTCTCATTTCTGATGAACGTTAGACTCC

TTTAGATGTTCCTTTAAAAAAAAAAATCTGGCTTTTGCCGTGTATTGAGTGGCTACGTCTTCAGTCTTTCCCCTCCTAAGGAAATTACCCTTACATATTT

ATGTGGGATTTCCAAAGACCTTTGGGATAATCCGTGAGATAGTGCATGGGCTTTTTGTCATGTACATAGGCTCAGCTTTTGTCCTGTGCTGTTTGTTCTT

CACTGTGCGCTCCCACTGGCGATGATCTGTGCAGTACAGTTGGTCTCATGGCGACTACCCGTATGCTTAAGCCTGAAAATTATTTCACAGTTCACTCAGC

CGACAACTCCCAAACTGAGTTGCATACTGCTTATCGACACGAGAGAGATAAGGGGCACACTTCCCTCGTTTTAAGGAAATACCTATTTTACTCTAGCCTA

ACACCTCCCAGTCAATGAATACTTACCATCATAAGTAGGGTTCACTGATACGTTTTTCAAACATGTGTTCGCGCTGATCAGTTTGGCATCTCCATGAATT

CGCCTGAAAAAAAAAAAAAGCCTATTTTGCTACCTACAGTAAATGGTGAAGGGGCTGTTTAAAAACCACACCCAGTTTTCTACAGTTTTTATGGTATTTT

TTTCATCTTAAAAGATAAAAAAAAAGGGGGGAGTTCTAGTTTTCAGATACACTTCAGAGATCGAAACAAACTCTTCTGCCTTCTATTCAAAAGCCTGTTT

GCCTTTTTGTGGATTACCAGCAAAATAGACCTTCAAACGTGTGCAAGGACTAGCTTTGAGAAGGGGTGTTTTCTCCATATTACCCCATTAAATCATTTCA

TTTCCCCTTCCCCCCTTTTCTTGGTCTGAATTTAAAATTAGGCTGTGTCTTCCTTCTCTAAAGCTGTAGCTAGTTTCCATCGTGTCTCCATACTCCCTGC

AAAGAAGATAAGGTTCTAAAAATTCACGTAATTGGAAAGGGAGCACAGTGGACACACTTCACATCTCAAATGGTCCCGTTTGGAGCTTAGATCAGCCACA

CGAGCATCAAAGCATCTAGCAGAACCACACAACATAGAATCTAAGCTGATCTTCCAGACTGTGAGGCTGCAGGCTTAGCTGTCCACCAGCTGAATCTGGA

GAGTGGGTTGTTCTCAGCCTTCTGGGGGTGACCATTGAGGTCATTCCCCCCAAAATGACTGGTTATCCAAGAAAGGCTTGCTTCCCTTGGCCCCGCCATC

AGAGGTATCTGTCTCCAGATTCCTCGCCTCAGAACATTGTCAATGAGAATGGGATCTTCTGACCTCTGCCTGGAAATCTAAAGTCATCTTTTTATCCTGA

ATCATAAATTATTTTGATGGAACTCTTCCACATGAGCACACTCAGTTATACAACATACCCTGAAAACGAGACTCTATATGCCTTTTGACCATGGATCCTG

TGTTTGAATGACAGGCATTAATTTGGTCTCTCTGTTCTTAAGTTGGGAAGAACACAGAGAGTGGCCATTTGGGTAAAACTTGAAATAGGGACTTGCTATA

GCAGTGAGTTTACAGAGACTTAATACTCTCAAGTTTCTAACCTTTGTCAGCTGGGGAAAAGGCACATGGTTTTACCATGGATTTGAATGGGTGCAGTCAA

AGTGACTTTAAGCCTATGTTTTCTGAAATAAACAACACAGAACTCCAATTTAAAAGTCCCCTGTAGGGGACTCTGGTAAATGCTGACATGAGTGCTTTGT

AACGTTTACAATCCAGAAAAGCGGGGCGGTGAATCGTTGGTGTTGGGTTGGGATATCGCACAGTAGTGGAGAGCATAGACTTTCTGTGTGTTAGATATAC

ACCTAACAATTCACTGCTGTATCACGCCTATAAGATGCACTATTGGTGAAGGTATTAGCAGGAAAGCAGTGTTCTTGGGAACGTAGGCCTTTTAACATGG

TAAATGTGCCTCTTGGCTGGTTCTCCACTCAGTGCTCCCTGGGAGCCGGGAGAACTTGCTGGATTGCTTCTTTGTCACCCTGGCAAGTGAAGGGATACTG

CCAAATAAGGGAGCCACGGACTGTGTTGTCATTAAAGAGAGTCAGTGAGTTGGTTTCCTTTCCATCAGGAAAAATGGATTCTGTAAAGAGTCAGGGCGTT

GTCTCAGCATTTGATGATATATTTTAATTTTTCAGTTCAGTATCCCAGATAGCTGGTGTGATGCTCACAATAGGTTAGTCTGTTCTATACTCAGTGTCAC

ACTCATAACCTGTGATTGAAAGCTGCCCTTTCAGAAAACGAATGCTAGTCAGAAGGCAATGGGTTGGCGTCCTTTTTAATCAGTGTGTAACTATTATAAA

GCTACCTGTTCATCATACACTTGGTTTTTTTTTTTTTTCTGATGTTTCCTGGTCTTAAAACTTGTATCATAAAATGAATCTCTAGTCTAATAATTAAGCT

ACAAAATTTATTAAGGAAATGCCCCACTCATTCACACCATGGTGAGCAAGTATGTGGAGTCCCTTCTGTCTGTTGCTTACAATAACACTGTGTGGCTCCG

TGCCTCATAAATGCTTTGTAATTGTGAGTATTTCTGGATTGTTTCTTAAACATATCATAGTCTGATTTTTCTCACATTAAAATAAAACAACTTGTGAAAC

TTAGTTATACTTTGCTGTGTTTTAATTAACCTTCAGCAGTTATTAAAGTGGAATGTCAGTTAAATTTTAAGAAAAGGAGATAAATGCCTTCTGTGTTTCA

TATTGATTTATTTTGTGTAGGAGAGCAGCTGTTTGAGTTTTTTGGTGTGTGTGTGTTTGTTTTTGTTTTTTGTATTTTTTTGATAGGTTTATGGTTTGCA

TGAATTAGTATTTAAGGTGATTCAGACTAATGCATGGCTTTTGTATAAATCCTTATATTTATTTCTGTCTTATGAAACTTTACCATGACCTAAGAAGAAT

TAATGGGCAAATTAATCGGTCCTCCACATGACTTTCTTTTTTTTTTTTTTTTAACATAAATGGGTTGTTTTCCAAGTTTCAACCAATTCGGCTGAATCTT

TTTTATTTAATTGAATCTTCTGTTTAGCTTCCCTCCGAGAACTCTCCTTTAGAAAGTTCATGAAACTTCTCAGCAAATCAATCTTCCTTAAGTAGGAAGA

AAGGTGGCCTGGCCTGTACGCTCCCTTTGAATTAGCAGCAACTTTCCATCGGTAAGTATGCTCTGGTGGAGATGAGATTCTCAGTTGTAGACTAGAAGCC

ATAAATGCAGCGAGTGCTGCTTGCAGCACCCTCTGGCTCATTTCTTGCCTTTGCAAGTGTATGAAGTTAAAAGTAAGAAGGCAGCCTTAGAAGGCAGCTA

TGAAAAGCCGCCGTTCGCTTTAAAAAAATAGACATTCAGCTCCGTGGAAAAGCCATTCCCGCCGTAACGGCTGTAAAGATGGTGGCGCTGCATGCTGCGT

GGATAGTGTCTAATCTGTGCTTAAAGTGGTTCTCTCAGGTTTGTGTATCTTGATGCTTGATGCACTGTGTTTTATAAATAGTTACAAATGTTGAGTAAAA

ACCATTTCTATGCACTGTTCCGTGTCATTGGCCTTTTGTGAATGTGCATGTTTTAAACTGCAAATTTTAAACATTTTGTCCTAATTGTTATTAAAAAATA

AAATAAACTTTACCATTACATAAA
Translation
MPTMRRTVSEIRSRAEG - UNI16938 - GYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVS STAKYNVITFLPRFLYSQFRRAANSFFLF

IALLQ QIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDI KRHKADNAVNKKQTQV VLRNGAWEIVHWEK VAVGEIVKVTNGEHLPADLLSLSSS SE

PQAMCYIETSNLDGETNLKIRQ GLPATSDIKDIDSLMRISGRIECESPNRHLYDFVGNIRLDGHG GTVPLGADQILLRGAQLRNTQWVHGIVVYTGHD

TKLMQ NSTSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLHLHY YGGASNFGLNFLTFIILFNNLIPISLLVTLEVVKFTQ

AYFINW DLDMHYEPTDTAAMARTSNLNEELGQ VKYIFSDKTGTLTCNVMQFKKCTIAGVAYG GHVPEPEDYGCSPDEW WQSSQFGDEKTFNDPSLL

DNLQNNH PTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPD DEGALVRAAKQLNFVFTGRTPDSVIIDS LGQEERYELLNVLEFTS SARKRMSV

VVRTPSGKLRLYCKGA DTVIYERLAETSKYKEITLKHLEQFATEG GLRTLCFAVAEISESDFEEWRAVYHRASTSVQNRLLKLEESYELIEK NLQLL

GATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIG GHSCRLLKRNMGMIVINEGSLD GTRETLSRHCTTLGDALRKENDFALIIDGKTLKY

ALTFGVRQYFLDLALSCKAVICCR RVSPLQKSEVVEMVKKQVKVITLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQ FKYLKNLLMVHG

AWNYNRVSKCILYCFYKNIVLYIIE IWFAFVNGFSGQILFERWCIGLYNV MFTAMPPLTLGIFERSCRKENMLKYPELYKTSQNALDFNTK VFWVHC

LNGLFHSVILFWFPLKALQYG GTVFGNGKTSDYLLLGNFVYT FVVITVCLKAGLETSYWTW FSHIAIWGSIALWVVFFGIYSSLWPAVPMAPDMSGE

 AAMLFSSGVFWVGLLSIPVASLLLDVLYKV VIKRTAFKTLVDEVQELEAKSQDPGAVVLGKS SLTERAQLLKNVFKKNHVNLYRSESLQQNLLH HG

YAFSQDENGIVSQSEVIRAYDTTKQRPDEW

For any suggestions or comments, please send an email to unitrap@crg.es