Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037712 (Plekhc1)
Chromosomal location
Chr 14: 46078467 - 46149793 (-)
Description
fermitin family homolog 2 (Drosophila) Gene [Source:MGI (curated);Acc:Plekhc1-001]
RefSeq_dna
NM_146054 
RefSeq_peptide
NP_666166.2 
UniGene
Mm.210018 
MGI
MGI:2385001 
Uniprot/SWISSPROT
Q8CIB5 
Uniprot/SPTREMBL
A6X940 A6X941 Q3TLE2 Q3UMA4 
Human Ortholog
ENSG00000073712 (PLEKHC1)
Omim not available
UniTrap UNI13552
Vector Insertion
Chr 14: 46124406 - 46149099
Public Clones CMHD-GT_300A1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21261
Vector Insertion
Chr 14: 46124406 - 46149099
Public Clones CMHD-GT_420G10-3 (cmhd) (cmhd) IST14380A4 (tigm)
Private Clones OST336893 (lexicon) OST240613 (lexicon) OST65323 (lexicon) OST30530 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15899
Vector Insertion
Chr 14: 46102242 - 46124171
Public Clones IST10545B9 (tigm)
Private Clones OST470668 (lexicon) OST462362 (lexicon) OST461404 (lexicon) OST460478 (lexicon)
OST459953 (lexicon) OST459938 (lexicon) OST459433 (lexicon) OST459295 (lexicon)
OST459114 (lexicon) OST458267 (lexicon) OST454309 (lexicon) OST453462 (lexicon)
OST453243 (lexicon) OST450630 (lexicon) OST445905 (lexicon) OST445663 (lexicon)
OST442998 (lexicon) OST349401 (lexicon) OST317483 (lexicon) OST232733 (lexicon)
OST70279 (lexicon) OST47529 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16481
Vector Insertion
Chr 14: 46095789 - 46102106
Public Clones not available
Private Clones OST460136 (lexicon) OST457719 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33946
Vector Insertion
Chr 14: 46088914 - 46092555
Public Clones IST14716H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33765
Vector Insertion
Chr 14: 46084758 - 46087138
Public Clones (sanger) IST11497H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2059
Vector Insertion
Chr 14: 46081916 - 46084398
Public Clones AM0293 (sanger) (sanger) YHC018 (baygenomics) IST12376F1 (tigm) IST15067B3 (tigm)
Private Clones OST449144 (lexicon) OST434449 (lexicon) OST367279 (lexicon) OST112360 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13465
Vector Insertion
Chr 14: 46079699 - 46081441
Public Clones CMHD-GT_247D05-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045905
Sequence
GGGGGCGGAGGCCGGCTGCGGGCGGTGCTGCGGGGCGGGGGCCGGGGCGGGGAGAGGGGGTGGGGCGGGGGCCGCGGTGCCGGGACTCCATTAGCAGCGG

CGCGAGGCTTCGCTTTCCTCCCGAGCAGCGACGCGGGTGCCGCCAGCCTCGCCTGTTGCCTCGGGAGCCCGGCGGGAGGAGCGCG GAAGGGAGCCATGG

CTCTGGACGGGATAAGGATGCCAGATGGCTGCTACGCGGACGGGACGTGGGAACTGAGCGTCCATGTCACGGACCTGAACCGTGATGTCACTCTGAGAGT

GACCGGGGAGGTGCACATCGGAGGGGTGATGCTGAAGTTGGTGGAAAAACTCG - UNI13552 - - UNI21261 - ATGTCAAAAAAGATTGGTCG

GACCATGCTCTCTGGTGGGAAAAGAAGAGGACTTGGCTGCTTAAGACACACTGGACCTTGGATAAGTGTGGCATCCAGGCAGATGCCAAGCTCCAGTTCA

CCCCGCAGCACAAACTGCTCCGCCTGCAGCTTCCCAACATGAAGTATGTGAAGGTGAAAGTGAACTTCTCTGACCGAGTCTTCAAGGCTGTGTCTGACAT

CTGCAAGACTTTCA - UNI15899 - ATATAAGACACCCTGAAGAACTTTCTCTCTTAAAAAAACCCAGAGATCCCACAAAGAAAAAAAAGAAAAAGC

TAGATGACCAGTCTGAAGACGAAGCGCTTGAGCTGGAAGGACCTCTTATCATGCCTGGATCAG - UNI16481 - GAAGCATATATTCAAGCCCGGGA

CTTTATAGTAAAACAATGACCCCTACTTACGACGCTCATGATGGAAGCCCTTTGTCACCAACTTCTGCCTGGTTTGGTGACAGTGCCCTGTCAGAAGGCA

ATCCTGGGATACTTGCTGTCAGTCAGCCAGTAACATCACCAGAAATACTGGCAAAAATGTTCAAGCCTCAAGCTCTTCTTGATAAAGCAAAAACCAACCA

AGG GTGGCTAGATTCCTCAAGATCTCTCATGGAGCAAGATGTGAAGGAGAACGAGGCCTTGCTGCTCCGATTCAAGTACTACAGCTTTTTTGATTTGAA

TCCAAAG - UNI33946 - TATGATGCCATCAGAATCAATCAGCTTTACGAGCAGGCCAAGTGGGCTCTTCTCCTAGAAGAGATCGAATGCACGGAAG

AAGAGATGATGATGTTCGCAGCCTTGCAG - UNI33946 - TATCATATCAATAAGCTGTCAATCATGACATCAGAAAATCATTTAAACAACAGTGAC

AAAGAAGTTGATGAAGTTGACGCTGCCCTTTCTGACCTGGAGATCACTTTGGAAGGCGGGAAAACATCAACAATTCTG - UNI33946 - GGTGACAT

TACTTCAATCCCAGAACTTGCTGACTATATTAAAGTTTTCAA - UNI33765 - GCCGAAGAAGCTGACTTTAAAGGGGTACAAGCAGTACTGGTGCA

CTTTCAAAGACACGTCCATCTCCTGCTACAAGAGCCGAGAAGAGTCCAGTGGTACACCTGCTCATCAGCTGAACCTCAGAG - UNI33765 - GATGT

GAAGTTACTCCGGATGTAAACATTTCAGGCCAGAAATTTAACATAAAACTCCTAATTCCGGTAGCAGAGGGCATGAATGAGATCTGGCTTCGCTGTGATA

AC - UNI33765 - GAGAAGCAGTACGCGCACTGGATGGCAGCTTGCAGGTTAGCCTCCAAAGGCAAGACCATGGCAGACAGTTCTTACAACCTGGAA

GTTCAGAACATTCTTTCCTTCCTGAAAATGCAGCATCTGAACCCAGACCCCCAGCTGATCCCTGACCAGATCACAACCGACGTCAACCCCGAGTGTCTGG

TGTCCCCGCGGTACCTGAAGAAGTATAAGAGCAAACAG - UNI2059 - ATAACAGCACGGATCTTGGAGGCCCATCAAAATGTAGCCCAGATGAGCC

TGATTGAAGCCAAGATGAGATTCATTCAAGCCTGGCAGTCTCTGCCTGAGTTCGGCATCACACACTTCATTGCGAG GTTTCAAGGCGGCAAGAGAGAAG

AACTTATTGGAATTGCATACAACAGGTTGATTCGGATGGACGCCAGCACAGGTGACGCCATCAAAACCTGGCGGTTCAGCAACATGAAGCAGTGGAATGT

CAACTGGGAGATCAAGATG - UNI13465 - GTCACTGTAGAGTTTGCAGATGAGGTCCGGTTGTCCTTCATCTGTACCGAAGTAGACTGCAAGGTGG

TCCACGAATTCATTGGTGGTTACATATTTCTCTCAACTCGTGCGAAAGACCAAAATGAAAGTTTAGATGAGGAGATGTTCTACAAACTCACCAGTGGTTG

GGTGTGAATAGGAAAACTTGTAATAAAACTCCACAGCCATAACAATATTTAACTTTAAAGCTATTGTTTCTTATATGCTGCTTAATAAAGTAAGCTTGAA

CTTTATTATTTTATCATGATACCTTTTTGCCTTACCAGACCAGTACATATGTGCACTAACAAGCACGATTGTTAATCTGCTGCCTACCTTGATATGCCGT

ATGTGGACTGTGGAATTCCCAACAGTCCTTAGGGCCACGGAAAGCTGTCACTGACTGACAGTAACCAAACTAAGAAACAAGCCATCTACCAAGCCACCCA

GGGCATACATATAACCTATATGAAGTCTATTTATCATGTGTAATGCATGTGTTTGTGTTTAATTGATGCCTTCTTTTAAAGTACCCTGCTCCTGGTACCC

AGTTAATCCCCTCTCCCAGTATAAAGTCGGTCTACAGTGGATGCTTGGTATTTGTTGATGCTGTTGACCTTGAAGGAAACACTGCTAACCTGTTGTTATT

GGGTGGGTTTTGTCTTTGAGTAAGCATGCTGTACATTGTTTTGTGTTTAGTTTTACACCAAACTGTATTACAGTACTCTTAGTATTCACCAGCATACTCA

CTATCTGCCTAAGATATGCAGCCTTTGTGTTACAATATGAAGTAAAGATCTATGAAGTATTCATTTTGTGTAACTAATGTACAAACACAAATTTTATAAA

ATTGTACAGTTTTTTTTAAAAAAAACTATTCACAACTAGGAAATGGCTTAAATGTAGCATCCTTACATTAATTAAGTGCTTTTAAAATATATAATTAATT

TGCAGTTTCAGTATCTGCTAAATTACGAATGACTTCATGATGCTCGTGACTTGCCGTGATGCCCTTAACTACAGCCTGGACCGGCTGTGTTCTAGTCTGT

TGCGCTATTACATCTGCGTTGGTGCTAGTTAGACAATTCCTAGCTCACGAGCCCAGAAGGGCGCCAGGGAGGGGTGGACTTACCAGTATTGTCCAATAAT

CCATGAATTAAAGACTGTATAAATGCATTTTATTTTAAATAAAAGTAAAACCTTTTATTTAATGT
Translation
 MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLD - UNI13552 - - UNI21261 - DVKKDWSDHALWWEKKRTW

LLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFN - UNI15899 - NIRHPEELSLLKKPRDPTKKKKKKLD

DQSEDEALELEGPLIMPGSG - UNI16481 - GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPEILAKMFKPQA

LLDKAKTNQG GWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPK - UNI33946 - YDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQ - U

NI33946 - YHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTIL - UNI33946 - GDITSIPELADYIKVFK - UNI33765 - 

KPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRG - UNI33765 - GCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDN - UNI3

3765 - EKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPDQITTDVNPECLVSPRYLKKYKSKQ - UNI2059 - ITARIL

EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIAR RFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKM - UNI13465 - V

TVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Transcript ENSMUST00000116488
Sequence
CGGGACTCCATTAGCAGCGGCGCGAGGCTTCGCTTTCCTCCCGAGCAGCGACGCGGGTGCCGCCAGCCTCGCCTGTTGCCTCGGGAGCCCGGCGGGAGGA

GCG GAAGGGAGCCATGGCTCTGGACGGGATAAGGATGCCAGATGGCTGCTACGCGGACGGGACGTGGGAACTGAGCGTCCATGTCACGGACCTGAACCG

TGATGTCACTCTGAGAGTGACCGGGGAGGTGCACATCGGAGGGGTGATGCTGAAGTTGGTGGAAAAACTCG - UNI13552 - - UNI21261 - AT

GTCAAAAAAGATTGGTCGGACCATGCTCTCTGGTGGGAAAAGAAGAGGACTTGGCTGCTTAAGACACACTGGACCTTGGATAAGTGTGGCATCCAGGCAG

ATGCCAAGCTCCAGTTCACCCCGCAGCACAAACTGCTCCGCCTGCAGCTTCCCAACATGAAGTATGTGAAGGTGAAAGTGAACTTCTCTGACCGAGTCTT

CAAGGCTGTGTCTGACATCTGCAAGACTTTCA - UNI15899 - ATATAAGACACCCTGAAGAACTTTCTCTCTTAAAAAAACCCAGAGATCCCACAA

AGAAAAAAAAGAAAAAGCTAGATGACCAGTCTGAAGACGAAGCGCTTGAGCTGGAAGGACCTCTTATCATGCCTGGATCAG - UNI16481 - GAAGC

ATATATTCAAGCCCGGGACTTTATAGTAAAACAATGACCCCTACTTACGACGCTCATGATGGAAGCCCTTTGTCACCAACTTCTGCCTGGTTTGGTGACA

GTGCCCTGTCAGAAGGCAATCCTGGGATACTTGCTGTCAGTCAGCCAGTAACATCACCAGAAATACTGGCAAAAATGTTCAAGCCTCAAGCTCTTCTTGA

TAAAGCAAAAACCAACCAAGG GTGGCTAGATTCCTCAAGATCTCTCATGGAGCAAGATGTGAAGGAGAACGAGGCCTTGCTGCTCCGATTCAAGTACTA

CAGCTTTTTTGATTTGAATCCAAAG - UNI33946 - TATGATGCCATCAGAATCAATCAGCTTTACGAGCAGGCCAAGTGGGCTCTTCTCCTAGAAG

AGATCGAATGCACGGAAGAAGAGATGATGATGTTCGCAGCCTTGCAG - UNI33946 - TATCATATCAATAAGCTGTCAATCATGACATCAGAAAAT

CATTTAAACAACAGTGACAAAGAAGTTGATGAAGTTGACGCTGCCCTTTCTGACCTGGAGATCACTTTGGAAGGCGGGAAAACATCAACAATTCTG - U

NI33946 - GGTGACATTACTTCAATCCCAGAACTTGCTGACTATATTAAAGTTTTCAA - UNI33765 - GCCGAAGAAGCTGACTTTAAAGGGGT

ACAAGCAGTACTGGTGCACTTTCAAAGACACGTCCATCTCCTGCTACAAGAGCCGAGAAGAGTCCAGTGGTACACCTGCTCATCAGCTGAACCTCAGAG 

- UNI33765 - GATGTGAAGTTACTCCGGATGTAAACATTTCAGGCCAGAAATTTAACATAAAACTCCTAATTCCGGTAGCAGAGGGCATGAATGAGA

TCTGGCTTCGCTGTGATAAC - UNI33765 - GAGAAGCAGTACGCGCACTGGATGGCAGCTTGCAGGTTAGCCTCCAAAGGCAAGACCATGGCAGAC

AGTTCTTACAACCTGGAAGTTCAGAACATTCTTTCCTTCCTGAAAATGCAGCATCTGAACCCAGACCCCCAGCTGATCCCTGACCAGATCACAACCGACG

TCAACCCCGAGTGTCTGGTGTCCCCGCGGTACCTGAAGAAGTATAAGAGCAAACAG - UNI2059 - ATAACAGCACGGATCTTGGAGGCCCATCAAA

ATGTAGCCCAGATGAGCCTGATTGAAGCCAAGATGAGATTCATTCAAGCCTGGCAGTCTCTGCCTGAGTTCGGCATCACACACTTCATTGCGAG GTTTC

AAGGCGGCAAGAGAGAAGAACTTATTGGAATTGCATACAACAGGTTGATTCGGATGGACGCCAGCACAGGTGACGCCATCAAAACCTGGCGGTTCAGCAA

CATGAAGCAGTGGAATGTCAACTGGGAGATCAAGATG - UNI13465 - GTCACTGTAGAGTTTGCAGATGAGGTCCGGTTGTCCTTCATCTGTACCG

AAGTAGACTGCAAGGTGGTCCACGAATTCATTGGTGGTTACATATTTCTCTCAACTCGTGCGAAAGACCAAAATGAAAGTTTAGATGAGGAGATGTTCTA

CAAACTCACCAGTGGTTGGGTGTGAATAGGAAAACTTGTAATAAAACTCCACAGCCATAACAATATTTAACTTTAAAGCTATTGTTTCTTATATGCTGCT

TAATAAAGTAAGCTTGAACTTT
Translation
 MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLD - UNI13552 - - UNI21261 - DVKKDWSDHALWWEKKRTW

LLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFN - UNI15899 - NIRHPEELSLLKKPRDPTKKKKKKLD

DQSEDEALELEGPLIMPGSG - UNI16481 - GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPEILAKMFKPQA

LLDKAKTNQG GWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPK - UNI33946 - YDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQ - U

NI33946 - YHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTIL - UNI33946 - GDITSIPELADYIKVFK - UNI33765 - 

KPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRG - UNI33765 - GCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDN - UNI3

3765 - EKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPDQITTDVNPECLVSPRYLKKYKSKQ - UNI2059 - ITARIL

EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIAR RFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKM - UNI13465 - V

TVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV

For any suggestions or comments, please send an email to unitrap@crg.es