Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037716 (Ccdc33)
Chromosomal location
Chr 9: 57876484 - 57966630 (-)
Description
coiled-coil domain containing 33 Gene [Source:MGI (curated);Acc:Ccdc33-001]
RefSeq_dna
NM_029212 
RefSeq_peptide
NP_083488.1 
UniGene
Mm.335193 
MGI
MGI:1922464 
Uniprot/SWISSPROT
Q3ULW6 
Human Ortholog
ENSG00000140481 (CCDC33)
Omim not available
UniTrap UNI33398
Vector Insertion
Chr 9: 57929766 - 57934484
Public Clones IST14731G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20738
Vector Insertion
Chr 9: 57925437 - 57928583
Public Clones not available
Private Clones OST353309 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32812
Vector Insertion
Chr 9: 57881362 - 57906204
Public Clones IST14968A7 (tigm) IST12862C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20737
Vector Insertion
Chr 9: 57877769 - 57878140
Public Clones not available
Private Clones OST353337 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098681
Sequence
CTTTCCGACTGGACCCAGGATGGGACTGTGAGCAGGAGAGGGCAGGGCTCAGCCTGGAGTTCTGACCCTGGCTGAAGCCATGGCCTTTAGAGGTCCTGAT

CCCTACCTCCCTGCATCCCTGCTGAGCCAGCGACTGAAGGCTGGAGAGAAGACACTGGACCTGGAGTTTGAGATCTTGAGTGTGGGATTTAATGAGGAGG

GCCGGTACGCCCTGAGGCTGTCAGCTGAAAACCCACTGCAGGCAGGCTCCAGTGCTGGGGTGCAGTTGCAAGTCAATGATGGGGACCCCCTTCCAGCCTG

CTCAGCTGTCACTGAGGTCATTGAGCAGCAGGATCCTGGCCAGAGCCTCACCTTCACCAGGAACAAATTTATCTTCACTCTGCCCAAAG GGTTCTGTAA

GAATGATGGGCAGAGTGATGCACATCTGCGTGTGGAGGCTCTGAGGCTGGATGGATCCTCAGGACAGGAGGCTCAGAGGGTAGGTGAGGCCATCTTCCCC

ATTTACCCACGACCAGATGAGCCCCGAATGAACCTCACAGCACAGGATCATGAAGACCTGTACCGCTATTGTGGCAACCTGGCTCTTCTCCGAGCCAGCG

AGGACCCCACAGCCCGCCACTGTGGGGGCCTGGCTTACAGTGTGGCCTTCCATGTGCACAGGGACCCTAGGTCCTCTGTCTCAGACTGTCAACTGGAACC

CAGCCAACCAGAGCTACAG ACTTCGAGGGAGGCCCTGAGTGACAAGATAGAAGAATCTTATATGAGCCCATTCAGCACTGACAGTGACCAGGAGGGGCT

CAGCTGGGAAGCAGGACCCTGGCAGCATCCGGCTCAG GCAGAGCTGTTGAAGAGGGAAACTTTGAACTGGAAATCCCCAG TTACAGGATTTTCTCAGC

CTCTGCTTCCCCACCTGTGA
Translation
MAFRGPDPYLPASLLSQRLKAGEKTLDLEFEILSVGFNEEGRYALRLSAENPLQAGSSAGVQLQVNDGDPLPACSAVTEVIEQQDPGQSLTFTRNKFIFT

LPKG GFCKNDGQSDAHLRVEALRLDGSSGQEAQRVGEAIFPIYPRPDEPRMNLTAQDHEDLYRYCGNLALLRASEDPTARHCGGLAYSVAFHVHRDPRS

SVSDCQLEPSQPELQ TSREALSDKIEESYMSPFSTDSDQEGLSWEAGPWQHPAQ AELLKRETLNWKSPV VTGFSQPLLPHL
Transcript ENSMUST00000119665
Sequence
CTAACCTCCTGCTTAGCTGTCCATGGCCCAGAAACTCTAAGGCACCTCCACCCACAGGATCTCCCACTTCTGAGAAAGATCCAGATTGCATCCTCCCACT

CAACATCCCCTACCCAGTCCAGCCCCCAAAGCAGTGTGTGGCACCCATGAGATCACACTGATGGGGAAAGACTCAAGGCACCTGGGCCTGCTGGATGGCG

AGGCCCATGGCTGATTGCCTGCCCATACCCAGGGCTGATACTAACCCCCTAGACTGCTAAGTGAACACTCTGCCCCCAAGAGGATGGGACGACAGAAGAC

AAAG GTTCCTGAGGAACCACAGGGCCGCCTGGATACCTCCCAGGACCCATATCCTGCCGCCAACTACCTGGCTCCCTGTAATAAGGAGACTATCACTGT

CACTCTATATGGAGCTACCAACCTTCCTGCCGGCAAGGATGGCTCTGAACCGTGGCCCTACGTGGTGGT - UNI33398 - AAAAACCACATCAGAGA

AAGCCAACAAACACAGTCCTCAAGCGATGACCTCTGTGACCTCAGAACCCACCAGAGCCCCCGTCTGGGGGGACACAGTGAATGTGGAGATCCAGGCAGA

GGACACAGGACGGGAAG - UNI33398 - ATTTGATCCTCAAGGTGATGGACAACAAGAGGAAGAAGGAGCTGGTGTCCTACGACATCCCCATTAAAT

ACCTGCGCATCTTCCACCCATACCAATTTAAGTTAGAAAAG - UNI33398 - TCTGAGAAAAAAGATGAAGCTGCTGCCAAGACCTGCCTGTATGCC

ACCGTGGTTCGGAAGGGCAGCTTACTTCCCCGCTACGTTGGCTGTGACCATACAGCTCTGGAG - UNI20738 - GTCTTTCTTCGAGGAGTCAACGA

GCCCTTAGTCAACAGCCTCAAGCCCATGGTGGTAATTGCTCGGGTAGTTCCCAACTATACTGAGTTTAA GGCCAGGCAGGCCAGGCGGGATCCTGCCTC

TGTGGGGCTGCCCCTCACCCAGGTTTCCTTCCCTATCTCATCGCCAATGAACTTTGATGTGCCTCGGATCAACCAGAACGGGTATCCTCAG CTGTCCAA

GCCTGGGGGACCCCCAGAGCAGCCCTTGTGGAACCAGTCCTTCCTCTTCCAAGCCCGAGATGGGGCCACCAGTTTCTCAGAGAACACAGCCCTGGTGCTG

GAGTACTACCCCTCTGCCTCAA TGCAAAGCAGTGAGCCATGGGCCCTCAACCAGCCCCTGGGTGTATCGGTGTTACCACTGAAATCTCGTCTATACCAC

AAGATGTTGACAGGAAAACACTTGCAAGGGCTGCAAGTGGAGCGGCTTCCCATCATC GACACCAACCTAAAAACCATCAATGGAGAAGCCCCCTCGGTG

AACCTCTCCTTCCAGCTGCTTTCCTCTGAG - UNI32812 - AGACCAGAAAACTTCTTGACACCAAACAACAGCAAGGCTCTGCCCACCATCAACCC

CAAGATCCTAGATGAGAATCTGGGTGCCATCCGTGAATCCTGGTCCATGAGCTCCTTAGACTCCACTCAGGAAATGGAGGAACTTCAGCCCCGTGATGTG

 - UNI32812 - GAGATGAACAATTACCGGCGGGCCATGCAGAAGATGGCAGAGGACATCCTGGCACTGAAGAAGCAGGCTAACATCCTGGAGGAGGA

GAACGGCATGCTGAGGAGCCACCTGAGCCAGCAGAGCATAGAAGAGCAGAGCAGGGCGGAGGAAGAGAACCTGG - UNI32812 - TGTCCATGAAGC

AGAAGCTACTGCTGAACGAACTGGATATGAAGAGGCTGCGAGACAGGGTGCAGCACCTGCAAAATGAGCTGATTCGG AAGAATGACCGAGAGAAGGAGC

TGCTGCTTCTGTACCAGGCTCAGCAGCCCCAGGCTGCACAGCTGAGGCGCTACCAGGACAAGCTGCAGAAGATGAAGGCCCTGGAGGACACTGTACGGCA

CCAGGAGAAG GTGATCGAGAAGATGGAGCAGATATTGGAAGAAAGGCTCTGTGAGAGGAAGGAACCAATACCATCAAACAGGCCACAGGGGAAGCCTAT

CATGG CCTCGGGCATTCCTCTGGGCCCCGTGGGAGAGACCCTGGCTGTTGACCTTTACTCCATGCTGCTAGCAGAAAACACGAGGCTTCGGACAGAGCT

GGAAAAGAACCGCCAGCAGTCAGCCCCCATCATTCTGCAGCAGCAGGCCCTACCG GACTTCCTTGGTGGTACTTCAGACAAGTTTAACCTCCTGGCCAA

GCTAGAACAAGCTCAGAGTCGGATCTTGTCCCTGGAAAACCAG - UNI20737 - CTGGAGGAGTCAGCTCGCCACTGGGCACGAGAGAAGCAAAACC

TGGCCATTCGTCTTCAAGAGCAACAACACGGCTTTGGACAGCCACCAAACTCCATCATCATAGACCAGCCT AATGCTGGAGCATCCAAGAATCGCCAGC

AGCTCTCGAAACTGGAAACCTCCCTGCCCAGCTCAGACAAGAAGCTCAACAGACCCTCAGACTCTCAGATTGAGATCTCTAACAACCAGAAGACCTGAGA

CCGGAGCAGATCTCCTTCGCCATGTGCTGGGGATTCACGTGCCCCCAAAGACGCCTTTAATAAAAGCTGTCAGT
Translation
MGRQKTK VPEEPQGRLDTSQDPYPAANYLAPCNKETITVTLYGATNLPAGKDGSEPWPYVVV - UNI33398 - VKTTSEKANKHSPQAMTSVTSEP

TRAPVWGDTVNVEIQAEDTGRED - UNI33398 - DLILKVMDNKRKKELVSYDIPIKYLRIFHPYQFKLEK - UNI33398 - SEKKDEAAAKTC

LYATVVRKGSLLPRYVGCDHTALE - UNI20738 - VFLRGVNEPLVNSLKPMVVIARVVPNYTEFK KARQARRDPASVGLPLTQVSFPISSPMNFD

VPRINQNGYPQ LSKPGGPPEQPLWNQSFLFQARDGATSFSENTALVLEYYPSASM MQSSEPWALNQPLGVSVLPLKSRLYHKMLTGKHLQGLQVERLP

II DTNLKTINGEAPSVNLSFQLLSSE - UNI32812 - RPENFLTPNNSKALPTINPKILDENLGAIRESWSMSSLDSTQEMEELQPRDV - UNI3

2812 - EMNNYRRAMQKMAEDILALKKQANILEEENGMLRSHLSQQSIEEQSRAEEENLV - UNI32812 - VSMKQKLLLNELDMKRLRDRVQHLQ

NELIR KNDREKELLLLYQAQQPQAAQLRRYQDKLQKMKALEDTVRHQEK VIEKMEQILEERLCERKEPIPSNRPQGKPIMA ASGIPLGPVGETLAVD

LYSMLLAENTRLRTELEKNRQQSAPIILQQQALP DFLGGTSDKFNLLAKLEQAQSRILSLENQ - UNI20737 - LEESARHWAREKQNLAIRLQEQ

QHGFGQPPNSIIIDQP NAGASKNRQQLSKLETSLPSSDKKLNRPSDSQIEISNNQKT
Transcript ENSMUST00000042205
Sequence
GTACTTTCCCAGGACTGGGCAGAACAAGGATCACCCCACTTCACCCTCCTGAGGCTGCCAGGAATCCGTTCCCTAACCTCCTGCTTAGCTGTCCATGGCC

CAGAAACTCTAAGGCACCTCCACCCACAGGATCTCCCACTTCTGAGAAAGATCCAGATTGCATCCTCCCACTCAACATCCCCTACCCAGTCCAGCCCCCA

AAGCAGTGTGTGGCACCCATGAGATCACACTGATGGGGAAAGACTCAAGGCACCTGGGCCTGCTGGATGGCGAGGCCCATGGCTGATTGCCTGCCCATAC

CCAGGGCTGATACTAACCCCCTAGACTGCTAAGTGAACACTCTGCCCCCAAGAGGATGGGACGACAGAAGACAAAG GTTCCTGAGGAACCACAGGGCCG

CCTGGATACCTCCCAGGACCCATATCCTGCCGCCAACTACCTGGCTCCCTGTAATAAGGAGACTATCACTGTCACTCTATATGGAGCTACCAACCTTCCT

GCCGGCAAGGATGGCTCTGAACCGTGGCCCTACGTGGTGGT - UNI33398 - AAAAACCACATCAGAGAAAGCCAACAAACACAGTCCTCAAGCGAT

GACCTCTGTGACCTCAGAACCCACCAGAGCCCCCGTCTGGGGGGACACAGTGAATGTGGAGATCCAGGCAGAGGACACAGGACGGGAAG - UNI33398

 - ATTTGATCCTCAAGGTGATGGACAACAAGAGGAAGAAGGAGCTGGTGTCCTACGACATCCCCATTAAATACCTGCGCATCTTCCACCCATACCAATT

TAAGTTAGAAAAG - UNI33398 - TCTGAGAAAAAAGATGAAGCTGCTGCCAAGACCTGCCTGTATGCCACCGTGGTTCGGAAGGGCAGCTTACTTC

CCCGCTACGTTGGCTGTGACCATACAGCTCTGGAG - UNI20738 - GTCTTTCTTCGAGGAGTCAACGAGCCCTTAGTCAACAGCCTCAAGCCCATG

GTGGTAATTGCTCGGGTAGTTCCCAACTATACTGAGTTTAA GGCCAGGCAGGCCAGGCGGGATCCTGCCTCTGTGGGGCTGCCCCTCACCCAGGTTTCC

TTCCCTATCTCATCGCCAATGAACTTTGATGTGCCTCGGATCAACCAGAACGGGTATCCTCAG CTGTCCAAGCCTGGGGGACCCCCAGAGCAGCCCTTG

TGGAACCAGTCCTTCCTCTTCCAAGCCCGAGATGGGGCCACCAGTTTCTCAGAGAACACAGCCCTGGTGCTGGAGTACTACCCCTCTGCCTCAA TGCAA

AGCAGTGAGCCATGGGCCCTCAACCAGCCCCTGGGTGTATCGGTGTTACCACTGAAATCTCGTCTATACCACAAGATGTTGACAGGAAAACACTTGCAAG

GGCTGCAAGTGGAGCGGCTTCCCATCATC GACACCAACCTAAAAACCATCAATGGAGAAGCCCCCTCGGTGAACCTCTCCTTCCAGCTGCTTTCCTCTG

AG - UNI32812 - AGACCAGAAAACTTCTTGACACCAAACAACAGCAAGGCTCTGCCCACCATCAACCCCAAGATCCTAGATGAGAATCTGGGTGCC

ATCCGTGAATCCTGGTCCATGAGCTCCTTAGACTCCACTCAGGAAATGGAGGAACTTCAGCCCCGTGATGTG - UNI32812 - GAGATGAACAATTA

CCGGCGGGCCATGCAGAAGATGGCAGAGGACATCCTGGCACTGAAGAAGCAGGCTAACATCCTGGAGGAGGAGAACGGCATGCTGAGGAGCCACCTGAGC

CAGCAGAGCATAGAAGAGCAGAGCAGGGCGGAGGAAGAGAACCTGG - UNI32812 - CAGTGTCCATGAAGCAGAAGCTACTGCTGAACGAACTGGA

TATGAAGAGGCTGCGAGACAGGGTGCAGCACCTGCAAAATGAGCTGATTCGG AAGAATGACCGAGAGAAGGAGCTGCTGCTTCTGTACCAGGCTCAGCA

GCCCCAGGCTGCACAGCTGAGGCGCTACCAGGACAAGCTGCAGAAGATGAAGGCCCTGGAGGACACTGTACGGCACCAGGAGAAG GTGATCGAGAAGAT

GGAGCAGATATTGGAAGAAAGGCTCTGTGAGAGGAAGGAACCAATACCATCAAACAGGCCACAGGGGAAGCCTATCATGG CCTCGGGCATTCCTCTGGG

CCCCGTGGGAGAGACCCTGGCTGTTGACCTTTACTCCATGCTGCTAGCAGAAAACACGAGGCTTCGGACAGAGCTGGAAAAGAACCGCCAGCAGTCAGCC

CCCATCATTCTGCAGCAGCAGGCCCTACCG GACTTCCTTGGTGGTACTTCAGACAAGTTTAACCTCCTGGCCAAGCTAGAACAAGCTCAGAGTCGGATC

TTGTCCCTGGAAAACCAG - UNI20737 - CTGGAGGAGTCAGCTCGCCACTGGGCACGAGAGAAGCAAAACCTGGCCATTCGTCTTCAAGAGCAACA

ACACGGCTTTGGACAGCCACCAAACTCCATCATCATAGACCAGCCT AATGCTGGAGCATCCAAGAATCGCCAGCAGCTCTCGAAACTGGAAACCTCCCT

GCCCAGCTCAGACAAGAAGCTCAACAGACCCTCAGACTCTCAGATTGAGATCTCTAACAACCAGAAGACCTGAGACCGGAGCAGATCTCCTTCGCCATGT

GCTGGGGATTCACGTGCCCCCAAAGACGCCTTTAATAAAAGCTGTCAGTCAATA
Translation
MGRQKTK VPEEPQGRLDTSQDPYPAANYLAPCNKETITVTLYGATNLPAGKDGSEPWPYVVV - UNI33398 - VKTTSEKANKHSPQAMTSVTSEP

TRAPVWGDTVNVEIQAEDTGRED - UNI33398 - DLILKVMDNKRKKELVSYDIPIKYLRIFHPYQFKLEK - UNI33398 - SEKKDEAAAKTC

LYATVVRKGSLLPRYVGCDHTALE - UNI20738 - VFLRGVNEPLVNSLKPMVVIARVVPNYTEFK KARQARRDPASVGLPLTQVSFPISSPMNFD

VPRINQNGYPQ LSKPGGPPEQPLWNQSFLFQARDGATSFSENTALVLEYYPSASM MQSSEPWALNQPLGVSVLPLKSRLYHKMLTGKHLQGLQVERLP

II DTNLKTINGEAPSVNLSFQLLSSE - UNI32812 - RPENFLTPNNSKALPTINPKILDENLGAIRESWSMSSLDSTQEMEELQPRDV - UNI3

2812 - EMNNYRRAMQKMAEDILALKKQANILEEENGMLRSHLSQQSIEEQSRAEEENLA - UNI32812 - AVSMKQKLLLNELDMKRLRDRVQHL

QNELIR KNDREKELLLLYQAQQPQAAQLRRYQDKLQKMKALEDTVRHQEK VIEKMEQILEERLCERKEPIPSNRPQGKPIMA ASGIPLGPVGETLAV

DLYSMLLAENTRLRTELEKNRQQSAPIILQQQALP DFLGGTSDKFNLLAKLEQAQSRILSLENQ - UNI20737 - LEESARHWAREKQNLAIRLQE

QQHGFGQPPNSIIIDQP NAGASKNRQQLSKLETSLPSSDKKLNRPSDSQIEISNNQKT
Transcript ENSMUST00000098682
Sequence
ATGGCCTTTAGAGGTCCTGATCCCTACCTCCCTGCATCCCTGCTGAGCCAGCGACTGAAGGCTGGAGAGAAGACACTGGACCTGGAGTTTGAGATCTTGA

GTGTGGGATTTAATGAGGAGGGCCGGTACGCCCTGAGGCTGTCAGCTGAAAACCCACTGCAGGCAGGCTCCAGTGCTGGGGTGCAGTTGCAAGTCAATGA

TGGGGACCCCCTTCCAGCCTGCTCAGCTGTCACTGAGGTCATTGAGCAGCAGGATCCTGGCCAGAGCCTCACCTTCACCAGGAACAAATTTATCTTCACT

CTGCCCAAAG GGTTCTGTAAGAATGATGGGCAGAGTGATGCACATCTGCGTGTGGAGGCTCTGAGGCTGGATGGATCCTCAGGACAGGAGGCTCAGAGG

GTAGGTGAGGCCATCTTCCCCATTTACCCACGACCAGATGAGCCCCGAATGAACCTCACAGCACAGGATCATGAAGACCTGTACCGCTATTGTGGCAACC

TGGCTCTTCTCCGAGCCAGCGAGGACCCCACAGCCCGCCACTGTGGGGGCCTGGCTTACAGTGTGGCCTTCCATGTGCACAGGGACCCTAGGTCCTCTGT

CTCAGACTGTCAACTGGAACCCAGCCAACCAGAGCTACAG ACTTCGAGGGAGGCCCTGAGTGACAAGATAGAAGAATCTTATATGAGCCCATTCAGCAC

TGACAGTGACCAGGAGGGGCTCAGCTGGGAAGCAGGACCCTGGCAGCATCCGGCTCAG GTTCCTGAGGAACCACAGGGCCGCCTGGATACCTCCCAGGA

CCCATATCCTGCCGCCAACTACCTGGCTCCCTGTAATAAGGAGACTATCACTGTCACTCTATATGGAGCTACCAACCTTCCTGCCGGCAAGGATGGCTCT

GAACCGTGGCCCTACGTGGTGGT - UNI33398 - AAAAACCACATCAGAGAAAGCCAACAAACACAGTCCTCAAGCGATGACCTCTGTGACCTCAGA

ACCCACCAGAGCCCCCGTCTGGGGGGACACAGTGAATGTGGAGATCCAGGCAGAGGACACAGGACGGGAAG - UNI33398 - ATTTGATCCTCAAGG

TGATGGACAACAAGAGGAAGAAGGAGCTGGTGTCCTACGACATCCCCATTAAATACCTGCGCATCTTCCACCCATACCAATTTAAGTTAGAAAAG - UN

I20738 - - UNI33398 - GTCTTTCTTCGAGGAGTCAACGAGCCCTTAGTCAACAGCCTCAAGCCCATGGTGGTAATTGCTCGGGTAGTTCCCAAC

TATACTGAGTTTAA GGCCAGGCAGGCCAGGCGGGATCCTGCCTCTGTGGGGCTGCCCCTCACCCAGGTTTCCTTCCCTATCTCATCGCCAATGAACTTT

GATGTGCCTCGGATCAACCAGAACGGGTATCCTCAG CTGTCCAAGCCTGGGGGACCCCCAGAGCAGCCCTTGTGGAACCAGTCCTTCCTCTTCCAAGCC

CGAGATGGGGCCACCAGTTTCTCAGAGAACACAGCCCTGGTGCTGGAGTACTACCCCTCTGCCTCAA TGCAAAGCAGTGAGCCATGGGCCCTCAACCAG

CCCCTGGGTGTATCGGTGTTACCACTGAAATCTCGTCTATACCACAAGATGTTGACAGGAAAACACTTGCAAGGGCTGCAAGTGGAGCGGCTTCCCATCA

TC - UNI32812 - AGACCAGAAAACTTCTTGACACCAAACAACAGCAAGGCTCTGCCCACCATCAACCCCAAGATCCTAGATGAGAATCTGGGTGCC

ATCCGTGAATCCTGGTCCATGAGCTCCTTAGACTCCACTCAGGAAATGGAGGAACTTCAGCCCCGTGATGTG - UNI32812 - GAGATGAACAATTA

CCGGCGGGCCATGCAGAAGATGGCAGAGGACATCCTGGCACTGAAGAAGCAGGCTAACATCCTGGAGGAGGAGAACGGCATGCTGAGGAGCCACCTGAGC

CAGCAGAGCATAGAAGAGCAGAGCAGGGCGGAGGAAGAGAACCTGG - UNI32812 - CAGTGTCCATGAAGCAGAAGCTACTGCTGAACGAACTGGA

TATGAAGAGGCTGCGAGACAGGGTGCAGCACCTGCAAAATGAGCTGATTCGG AAGAATGACCGAGAGAAGGAGCTGCTGCTTCTGTACCAGGCTCAGCA

GCCCCAGGCTGCACAGCTGAGGCGCTACCAGGACAAGCTGCAGAAGATGAAGGCCCTGGAGGACACTGTACGGCACCAGGAGAAG GTGATCGAGAAGAT

GGAGCAGATATTGGAAGAAAGGCTCTGTGAGAGGAAGGAACCAATACCATCAAACAGGCCACAGGGGAAGCCTATCATGG CCTCGGGCATTCCTCTGGG

CCCCGTGGGAGAGACCCTGGCTGTTGACCTTTACTCCATGCTGCTAGCAGAAAACACGAGGCTTCGGACAGAGCTGGAAAAGAACCGCCAGCAGTCAGCC

CCCATCATTCTGCAGCAGCAGGCCCTACCG GTGGATCCCAGGGAGTTGGGAGCAGGTGGAGATTTGGCAGAAAGGCTACAAGACACAAATGGCCCGGGC

CACCCCAAGTCCACAGAGACCCTGCCAGCACAGGTGGGTGTCCCAGGAGGCTACTCCACTGCCCAGGCTGCTCCAGGTGCCCCTGCTGTACACAAACCCA

AAATCAATATTTGGAGCTCTGGTGGCATGAGAACACAG GACTTCCTTGGTGGTACTTCAGACAAGTTTAACCTCCTGGCCAAGCTAGAACAAGCTCAGA

GTCGGATCTTGTCCCTGGAAAACCAG - UNI20737 - CTGGAGGAGTCAGCTCGCCACTGGGCACGAGAGAAGCAAAACCTGGCCATTCGTCTTCAA

GAGCAACAACACGGCTTTGGACAGCCACCAAACTCCATCATCATAGACCAGCCT AATGCTGGAGCATCCAAGAATCGCCAGCAGCTCTCGAAACTGGAA

ACCTCCCTGCCCAGCTCAGACAAGAAGCTCAACAGACCCTCAGACTCTCAGATTGAGATCTCTAACAACCAGAAGACCTGAGACCGGAGCAGATCTCCTT

CGCCATGTGCTGGGGATTCACGTGCCCCCAAAGACGCCTTTAATAAAAGCTGTCAGTCAATA
Translation
MAFRGPDPYLPASLLSQRLKAGEKTLDLEFEILSVGFNEEGRYALRLSAENPLQAGSSAGVQLQVNDGDPLPACSAVTEVIEQQDPGQSLTFTRNKFIFT

LPKG GFCKNDGQSDAHLRVEALRLDGSSGQEAQRVGEAIFPIYPRPDEPRMNLTAQDHEDLYRYCGNLALLRASEDPTARHCGGLAYSVAFHVHRDPRS

SVSDCQLEPSQPELQ TSREALSDKIEESYMSPFSTDSDQEGLSWEAGPWQHPAQ VPEEPQGRLDTSQDPYPAANYLAPCNKETITVTLYGATNLPAGK

DGSEPWPYVVV - UNI33398 - VKTTSEKANKHSPQAMTSVTSEPTRAPVWGDTVNVEIQAEDTGRED - UNI33398 - DLILKVMDNKRKKEL

VSYDIPIKYLRIFHPYQFKLEK - UNI20738 - - UNI33398 - VFLRGVNEPLVNSLKPMVVIARVVPNYTEFK KARQARRDPASVGLPLTQV

SFPISSPMNFDVPRINQNGYPQ LSKPGGPPEQPLWNQSFLFQARDGATSFSENTALVLEYYPSASM MQSSEPWALNQPLGVSVLPLKSRLYHKMLTGK

HLQGLQVERLPII - UNI32812 - RPENFLTPNNSKALPTINPKILDENLGAIRESWSMSSLDSTQEMEELQPRDV - UNI32812 - EMNNYRR

AMQKMAEDILALKKQANILEEENGMLRSHLSQQSIEEQSRAEEENLA - UNI32812 - AVSMKQKLLLNELDMKRLRDRVQHLQNELIR KNDREKE

LLLLYQAQQPQAAQLRRYQDKLQKMKALEDTVRHQEK VIEKMEQILEERLCERKEPIPSNRPQGKPIMA ASGIPLGPVGETLAVDLYSMLLAENTRLR

TELEKNRQQSAPIILQQQALP VDPRELGAGGDLAERLQDTNGPGHPKSTETLPAQVGVPGGYSTAQAAPGAPAVHKPKINIWSSGGMRTQ DFLGGTSD

KFNLLAKLEQAQSRILSLENQ - UNI20737 - LEESARHWAREKQNLAIRLQEQQHGFGQPPNSIIIDQP NAGASKNRQQLSKLETSLPSSDKKLN

RPSDSQIEISNNQKT

For any suggestions or comments, please send an email to unitrap@crg.es