Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037720 (Tmem33)
Chromosomal location
Chr 5: 67651891 - 67682700 (+)
Description
transmembrane protein 33 Gene [Source:MGI (curated);Acc:Tmem33]
RefSeq_dna
NM_028975 
RefSeq_peptide
NP_083251.2 NP_084384.1 
UniGene
Mm.415829 Mm.470174 Mm.23217 Mm.397569 
MGI
MGI:1915128 
Uniprot/SWISSPROT
Q9CR67 
Uniprot/SPTREMBL
Q9CZM3 Q9CV90 Q9CWD1 
Human Ortholog
ENSG00000109133 (TMEM33)
Omim not available
UniTrap UNI23925
Vector Insertion
Chr 5: 67652202 - 67652273
Public Clones not available
Private Clones OST240320 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35386
Vector Insertion
Chr 5: 67652273 - 67654968
Public Clones IST14805E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34624
Vector Insertion
Chr 5: 67659884 - 67675378
Public Clones IST12243D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34561
Vector Insertion
Chr 5: 67675463 - 67677334
Public Clones IST14240A9 (tigm) IST13276H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117764
Sequence
CCCGCCTGACTCACGTGGAAACGAAAGGATCACTTCCGGTTTTGCAACCCCGGGAACCGGCGGCGTCGATCGGCCCTTTAAGGCCTTTCTCCGAAGCTCC

GCCTTCGCTTGGGTCTTTCTAGAAAGGCAGCTTCGGTCTGGACCGAGCGGGGCAG - UNI23925 - CGTCCCGGGCTCCCGAGTGTCTCCCATGGCG

GATACGACCCCGAACGGCCCCCAAGGGGCGGGCGCTGTG - UNI23925 - - UNI35386 - CAATTCATGATGACCAATAAATTGGACACAGCAA

TGTGGCTTTCTCGCCTGTTCACAGTTTATTGCTCCGCTCTGTTCGTTCTGCCTCTTCTTGG GTTGCATGAAGCAGCGAGCTTTTACCAGCGTGCTTTGC

TGGCCAATGCTCTGACCAGCGCTCTGAGGCTGCATCAGAGATTACCTCACTTCCAGTTGAGCAGAGCGTTCCTGGCTCAGGCCTTGTTAGAGGACAGCTG

CCACTACCTGCTGTATTCACTCATCTTCGTCAACTCCTACCCTGTCACAAGTATCCTTTCATTGCTGGGACAGTGGAGTTTTCCTGTTGGAAGGATACAG

TGATGATAGAGTTCATAAAGCTTGTTTTGCTTTTACTCTGTCACTTGAATTTTTGTCCCCAAAATTTGAAATATAAACTCTGTAGAGCTGTTTTGTGAAT

TTAAA
Translation
 - UNI23925 - MADTTPNGPQGAGAV - UNI23925 - - UNI35386 - QFMMTNKLDTAMWLSRLFTVYCSALFVLPLLG GLHEAASFYQR

ALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTSILSLLGQWSFPVGRIQ
Transcript ENSMUST00000119971
Sequence
AGGTATTACCGGGCCGCCATAGGGGGACTTCTGCGGCTGTGTGCTGCACGCGTCCGGGAGGGCCCGTTCCTCCGGGGGTTTGGGGTTCCTGCCGGCTCTG

AAAGCAGGTCGGAGGGTCGTCGCCCCGCACTGACGTTTTGCTCTTCTTTGCTGTTGCAGCGTCCCGGGCTCCCGAGTGTCTCCCATGGCGGATACGACCC

CGAACGGCCCCCAAGGGGCGGGCGCTGTG - UNI23925 - - UNI35386 - CAATTCATGATGACCAATAAATTGGACACAGCAATGTGGCTTTC

TCGCCTGTTCACAGTTTATTGCTCCGCTCTGTTCGTTCTGCCTCTTCTTGG GTTGCATGAAGCAGCGAGCTTTTACCAGCGTGCTTTGCTGGCCAATGC

TCTGACCAGCGCTCTGAGGCTGCATCAGAGATTACCTCACTTCCAGTTGAGCAGAGCGTTCCTGGCTCAGGCCTTGTTAGAGGACAGCTGCCACTACCTG

CTGTATTCACTCATCTTCGTCAACTCCTACCCTGTCACAA TGAGTATTTTTCCAGTCTTGTTATTTTCTTTGCTCCATGCTGCCACATACACTAAGAAG

GTCCTGGAC GCAAAGGGTTCAAATAGTTTACCTCTGTTGAGATCATTCTTGGATAAATTAAGTACTAACCAACAAAATATTCTGAAATTCATCGCTTGT

AATGAAATATTCTTGATGCCTGCTACAGTTTTTATGCTCTTTAG - UNI34624 - TGGCCAAGGAAGTTTGCTCCAGCCTTTTATATATTATAGATT

TCTTACTCTTCGATATTCCTCTAGAAGAAATCCATATTGTCG - UNI34561 - GAACTTGTTTAATGAACTGAGGATTGTGGTTGAACACATTATTA

TGAAGCCCTCCTGCCCACTGTTTGTGAGAAGACTATGTCTCCAGAGCATCGCCTTTATCAGCAGACTGGCACCAACAGTTGCGTAGTTTAACATCTAGTT

AAGCTGTGTTTAGAAGATTAACATTATTAGCTGGTAATTCTGATAGGGGTCCCAAATTACAGGTCTAACACTGACCTCAGTCCAATTTACATGATTTACA

TAAATGCATCTCAGTGCAAAAATAATAATTTTCCTGGCATGTTAAATCAAGCCTTTAACACTTTCTGAGAAAATTTTACTGTACATTACTGTTTGTGGTT

ATGTAAGTTTGTATTTAGTGATAAATGTTACTAAATTGTTTTAGATGCTGCTGTGCCTACATCATGAAATACATTTATTTCTTTTAAAAAGAATTCTGAA

ATTTGTTTTACCCTAACTATTAACCCACGTTATGTCTGTTGTGAGTTATGGTACTAGATGAGTTGAGTATGTTTGGAGACAGTGGTTTTCCATTCTGTAA

GTTGGGTTGAGATTTTAGCAGAAGCACACCTCCTGCAGTTTCAGTTCACACGCTACTATGCTGCTTTCTAGGGCAGGTGTGTTTAGCCTGCACCATAACA

GAGAAGTCTGTCTGCGTCTTATGACCTGTGAAGCTGTTGTTCCCATAGTGCATCTGTGGCTATGAATGATGTTTGAAAAATGGATTGCCTGTACACCTAT

TTTGAATTAGATCTTTGGGGCCATGTAATCATTTACTGTAGAAGACAGTAGTGACACAGAGACCTACTGACTAACTTTTATAAATGTCAACCAGTAGATT

ATCAGTGTTCCTATAGTTTGTAGGATTACATAGTTCCAGAATCTTGACTTTAGTTTTCTTGGTTTCTTAGGCTTGAAATTTCCTAGCCATGTGCAGCAGC

AGTTCAGATGCCTTTGAAAGGATATGATTGAAGACAGCATGTGATACACTTGTATGTTCTGAAATAATGAAGAATATTCTGTAGATGCATGTTTACCCAG

CAAATGTGGTTCAGAGGGTTTAATGGAAAGGGCTATGGGTAAGGCAACTCATGGGGAATGGGCCTGGGGAGTAGTTGAGGGCAGCGATGGGTGTTTCAGC

CTGGTAACGCATAGATGAGTTGGGGGGATTGGATGTATAATGCATCTGTGATTGAGGCTGTGTAATATGTTCAATTCTTTTCACTCAATTCTATTCCTTT

ATAAAAGGCATTCTGATCCTTACTACTCACTGTTGCATGATTGGAAGTACTTAAAACACTGCACAAGTTTAATATAGAGTAATGGAATGTGGCTTTTTTT

TTTAATACCCAGTTCTATCTGCATGTAATTTGGATTTTTCAAATACATTCATTAGTAACTTAAAACATCAGTTTTCTTTTTGTTTAAGTTACTAATCTAT

AGAAAGGTGATAGTCTTGGGGTAGATTTCCAGAAAATACTACTTGATAGCTTAGCTTTAACCAGCTACTTTTATATTTTTGTAATATTTATCCACCAAGT

TGGAGAAGCAACCTCATAATATCCAGTTGATTTTTTTATGTGTGTGCCTAGCCTCCTTATCACTATGTTTTAAGAATACAACTTTGTAGAGCAATAAAGT

GACTATCTTGTTATGTAAACATACTGATTTCTAATGATGTTTTAAAACATTGTCTTGAATGACATCAAGTTCTGGCAGCTAAAGGCATATTTATTTTGAA

ATGTGTTTTCTCCTACATTTTCCCCCCTAATCTTGGAACATTTTAGATTTATAAGAACTTCAAAAATAGTGCTGAGAGTGCCTATGCACCTCTTACTTGT

CTATTTTTATATTAGCGTCTTCTTTTAATTGGTAGGACATTTATGCAAAGTAAAATACTAACTTTGGATCA
Translation
MADTTPNGPQGAGAV - UNI23925 - - UNI35386 - QFMMTNKLDTAMWLSRLFTVYCSALFVLPLLG GLHEAASFYQRALLANALTSALRLH

QRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTM MSIFPVLLFSLLHAATYTKKVLD AKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLM

PATVFMLFS - UNI34624 - SGQGSLLQPFIYYRFLTLRYSSRRNPYCR - UNI34561 - RNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAF

ISRLAPTVA
Transcript ENSMUST00000037918
Sequence
CCCGCCTGACTCACGTGGAAACGAAAGGATCACTTCCGGTTTTGCAACCCCGGGAACCGGCGGCGTCGATCGGCCCTTTAAGGCCTTTCTCCGAAGCTCC

GCCTTCGCTTGGGTCTTTCTAGAAAGGCAGCTTCGGTCTGGACCGAGCGGGGCAG - UNI23925 - CGTCCCGGGCTCCCGAGTGTCTCCCATGGCG

GATACGACCCCGAACGGCCCCCAAGGGGCGGGCGCTGTG - UNI23925 - - UNI35386 - CAATTCATGATGACCAATAAATTGGACACAGCAA

TGTGGCTTTCTCGCCTGTTCACAGTTTATTGCTCCGCTCTGTTCGTTCTGCCTCTTCTTGG GTTGCATGAAGCAGCGAGCTTTTACCAGCGTGCTTTGC

TGGCCAATGCTCTGACCAGCGCTCTGAGGCTGCATCAGAGATTACCTCACTTCCAGTTGAGCAGAGCGTTCCTGGCTCAGGCCTTGTTAGAGGACAGCTG

CCACTACCTGCTGTATTCACTCATCTTCGTCAACTCCTACCCTGTCACAA TGAGTATTTTTCCAGTCTTGTTATTTTCTTTGCTCCATGCTGCCACATA

CACTAAGAAGGTCCTGGAC GCAAAGGGTTCAAATAGTTTACCTCTGTTGAGATCATTCTTGGATAAATTAAGTACTAACCAACAAAATATTCTGAAATT

CATCGCTTGTAATGAAATATTCTTGATGCCTGCTACAGTTTTTATGCTCTTTAG - UNI34624 - TGGCCAAGGAAGTTTGCTCCAGCCTTTTATAT

ATTATAGATTTCTTACTCTTCGATATTCCTCTAGAAGAAATCCATATTGTCG - UNI34561 - GAACTTGTTTAATGAACTGAGGATTGTGGTTGAA

CACATTATTATGAAGCCCTCCTGCCCACTGTTTGTGAGAAGACTATGTCTCCAGAGCATCGCCTTTATCAGCAGACTGGCACCAACAGTTGCGTAGTTTA

ACATCTAGTTAAGCTGTGTTTAGAAGATTAACATTATTAGCTGGTAATTCTGATAGGGGTCCCAAATTACAGGTCTAACACTGACCTCAGTCCAATTTAC

ATGATTTACATAAATGCATCTCAGTGCAAAAATAATAATTTTCCTGGCATGTTAAATCAAGCCTTTAACACTTTCTGAGAAAATTTTACTGTACATTACT

GTTTGTGGTTATGTAAGTTTGTATTTAGTGATAAATGTTACTAAATTGTTTTAGATGCTGCTGTGCCTACATCATGAAATACATTTATTTCTTTTAAAAA

GAATTCTGAAATTTGTTTTACCCTAACTATTAACCCACGTTATGTCTGTTGTGAGTTATGGTACTAGATGAGTTGAGTATGTTTGGAGACAGTGGTTTTC

CATTCTGTAAGTTGGGTTGAGATTTTAGCAGAAGCACACCTCCTGCAGTTTCAGTTCACACGCTACTATGCTGCTTTCTAGGGCAGGTGTGTTTAGCCTG

CACCATAACAGAGAAGTCTGTCTGCGTCTTATGACCTGTGAAGCTGTTGTTCCCATAGTGCATCTGTGGCTATGAATGATGTTTGAAAAATGGATTGCCT

GTACACCTATTTTGAATTAGATCTTTGGGGCCATGTAATCATTTACTGTAGAAGACAGTAGTGACACAGAGACCTACTGACTAACTTTTATAAATGTCAA

CCAGTAGATTATCAGTGTTCCTATAGTTTGTAGGATTACATAGTTCCAGAATCTTGACTTTAGTTTTCTTGGTTTCTTAGGCTTGAAATTTCCTAGCCAT

GTGCAGCAGCAGTTCAGATGCCTTTGAAAGGATATGATTGAAGACAGCATGTGATACACTTGTATGTTCTGAAATAATGAAGAATATTCTGTAGATGCAT

GTTTACCCAGCAAATGTGGTTCAGAGGGTTTAATGGAAAGGGCTATGGGTAAGGCAACTCATGGGGAATGGGCCTGGGGAGTAGTTGAGGGCAGCGATGG

GTGTTTCAGCCTGGTAACGCATAGATGAGTTGGGGGGATTGGATGTATAATGCATCTGTGATTGAGGCTGTGTAATATGTTCAATTCTTTTCACTCAATT

CTATTCCTTTATAAAAGGCATTCTGATCCTTACTACTCACTGTTGCATGATTGGAAGTACTTAAAACACTGCACAAGTTTAATATAGAGTAATGGAATGT

GGCTTTTTTTTTTAATACCCAGTTCTATCTGCATGTAATTTGGATTTTTCAAATACATTCATTAGTAACTTAAAACATCAGTTTTCTTTTTGTTTAAGTT

ACTAATCTATAGAAAGGTGATAGTCTTGGGGTAGATTTCCAGAAAATACTACTTGATAGCTTAGCTTTAACCAGCTACTTTTATATTTTTGTAATATTTA

TCCACCAAGTTGGAGAAGCAACCTCATAATATCCAGTTGATTTTTTTATGTGTGTGCCTAGCCTCCTTATCACTATGTTTTAAGAATACAACTTTGTAGA

GCAATAAAGTGACTATCTTGTTATGTAAACATACTGATTTCTAATGATGTTTTAAAACATTGTCTTGAATGACATCAAGTTCTGGCAGCTAAAGGCATAT

TTATTTTGAAATGTGTTTTCTCCTACATTTTCCCCCCTAATCTTGGAACATTTTAGATTTATAAGAACTTCAAAAATAGTGCTGAGAGTGCCTATGCACC

TCTTACTTGTCTATTTTTATATTAGCGTCTTCTTTTAATTGGTAGGACATTTATGCAAAGTAAAATACTAACTTTGGATCAGCTAAAGTACAAGATGTGT

TTGTATTTCACCAACTCTTTCATTTGTGTCGTGTGTGCGCTGTGTTGGTACCTGGATTGCCTTTTATGTTTCAAGGCCTATAAGTGAGTTTGTTCTTTAT

GGTATTGGTACAGAAACTTTCCTTAGAAGAGCTAATTCATGCTGACTTTAACATGAATTTTTTTCTTAAAATTGTAATTTCAAATGCTTAGTGATATAAT

TAAGACTCTTTAATGGCATTGCAGAATTTCATTATTTCTGATAACTTGTGCATGAGTGAAAATGTATATTTGTTCCTTAAGGGAAGGTGTAATATAATTC

TCAAGCCCATGAGAAGGCAAATTTTATAATTTGAACATTAATAGATGTTAGTTTGCATGAAGTTGCAGTTAGAAATATTATACTCTGTGTGAATATGTAC

AATCAACTGATCTCAAATCTGAAATTAGTGTTTCCATGTACACATGTCAAAAGTGAGGACATGACTAGTGCATAGAGTGGACGAGCAGGGGAACTTTAAT

ACTGCGTAACCAAGCAGTTTAAAGGAAGTTGATTGATCAAGCAGAATATCTAGTGCTTTGGAAACTGGAATGGTGCTGGCGTGTTTTAAACCTTGTTGGA

CAAGTGGAAGCTTCAGACAAAGTCTGTTGTTTTCTAACAAGCATTCAATTTCTACTGCATACTTCATCTCTCACCGAGTTGGCTGTAATTTAATAGTAAT

CCATAGAGCAATTTCTTAAGTATAATTTGTATTTAAATTTCCTTGAAATAAAATTTCACTAAGGGAGATGCTTTTGAAAGAAAAACAAGAGAGAAAGCTA

ATTTTAAAGATTAAGTTGAGATCTTTGTATATATCCCTGACAGAGAATGTCAAGGCAAGCTAGTAACAAACCTGAAGTTCTGGGAAGTGAATGATGCTGT

TAAATAAGAATCGCATCGTTCTCAGTCGGTATAGAGATGTAGACAGAAGTTTGAATTAGGTTTGTAAGTTTAGCGAATATCCTGGATAGGATCACGAATG

CATATATAATAAGACAAAGCAGAAGCCAGGTATCTAAGCATTTCAGATGGGGAAGTGAGCACCTGTGATTGTAGTTTAAAAAACAAAACAAAAACACTCA

GGTAGTGTATTGGAATTTGTATTGACTAACTCACCCAGGGAGAAATTAGCTGTGGACAGTTAGGTTTAGATCGGTAAGTGTCACTGTTTCCTTGGGTAGT

CCCCATTTTCACAAGTTGGGTTAGAAGATTATGCTGTGCTACTTAAAGTGCTTAGTAGACTATAACCCTAAGTATCTTGGTTCTATGACCCCTTTAATTC

AATAGTGGACAGTTATTTGCTAAGTATTTACTATGTGTGCTGTGAGATGGGGATGGGGATTGAAGCCAGGGCCCCTTGTTCTACTACTGAGCTATATTCC

CAGCTTATGAGTACCATTTTATAACAGTAAAACATTCAAAAGAAGTGCGTTGTCAATACAAGCCAGGAAAACAGGGCCCAGTCTGGAGTGGCGTGTGTGT

TAGTGTCTCTTCTTTTCATTTTCAGCCAGTCATCCAAGTACATAAATTGTTGAGGTTATTCTTTTCCCTTTTACAAATGTTCAAAGAAATGATAACTTTT

CTAATATAGAGAGATGGAATTTTAATTTTTTCATGATTATTTTGTAGGTACACTAGATAGAATCCGTTAAATTACAATTGAGATTTATTTTTTCCCCTGT

AATTTGAAAGCACTTGAGTGTTTGGAAACTACTATATCAGTAATGCTACCTAGGTTTGAAGATCGAGTGTAGTTCATAAAGACAACAAATTTTCGCTCCA

CCATTGGAATTCCCTGGATCAGGGAAGTTCAACACTGGCAATGTGTTGGTGTAGCTCAACAGGCACTACATAGCTTTGGAAGCCCGGAGTTGTTTCTCAG

CAGCTCCTTAATGCACATGGTCTTTCATAGTTTGACTGCAAAGCCATTCTTGGAGCTGGTGTCTATCAAAGATATCAAAGGAGCTGCTGGGAATTTGAAA

GGTTTCCTGTAATTAGTTAATCAGTGTGAATTTTGTGATTTTTGAGATGGCACTTAGGTGGCCCATTCAGAATGGATGGAATCTCGGGTAAAGGCTTCTC

TCTGTGGCCTTCTCTTTGTGATGCGCATGCCATGTACCCAGCCCACACTGAGTGTGAGTCAGTAGTGACAGACAGCATGCAGTAAGTATTCTCTGTATCT

CAAGTGGCTCTTTCTTAGAAAACCATAGGAAAAAGATTATTGATAGCTGTGTTTGCTAGAGTCTTTTAACGACGCTATTGGCTATTGTAGGAGAAAGAAG

GGCACAAGAGTCATACCCTACCTTTTCCTTCCTTCCCTCCTTCCTTCCTTCCATCCATCCATCCATCCATCCATCCCCCTGAGACGGGGTTTCTCTTTGT

AGACCTTTGAACCCAGGGATCCTCCTGTCTCTGCCTCCCATCTTTCCTAGTTTTTTAAAGGTACATTAAAAAAAATAGGCTCAGCATTTTTTAAACTAAC

GTTGTTCATAACATTTAATTCCAAACGTTTACTATTTTTTGTTACTTTAAGGACAATTCCTTTTGGCACTAGTTTTTGTCTACAAGTATCTGTAAGTTGA

GACCAAAAGAGCAAACTCTTAGCCAGGCAACACTTACATTGTGTATATATTGGAACAAATATACAAGGCTTGCAGAGATTAGCAATACTCATAGGAACTG

TTTGATTTATAACTGCATCGCTTCTGGTGCTTGATACAATGGGATCTATTGAGCTAAAAAAAATTGTATATACAGTACGTCAGCACTTCTTACGTCTCTT

GAATCCATTTTTAATATATTGTATAGGTTGGGGAGTTATATATACTCTTCAAGCCATTATTATCCTGGCTATAAATTTATAAAATAAATTGAAAAATTTA

TCACTCTCCTGTATTCAAGACCAAAGCACATAATGCTAATGTAGGGCTCAGAGGGGAAAATCTAGTTCTCCTGCATATTTGAGAAAACGTGGAGTCCTTT

CAAGAAAATGTAATAAACATAATAATCGTAGCCTGCTGACACTAAGGAAAAAGGCCTCATTCGCTCTTTCTTTTATGCAGCAATTTACTGGTCCCTGCTG

ATCTTCAAATTGGATCACTGTAGTAAATTATCCACGCTGGTACTGGTGGAAGTAAGCCCTAGGATCCATATTTGTTTTGTGTTCTGCTTAAATCAGCAAG

AATGATAAATTCGATGGTGTGAAATTGGAAGTATCAAGGGCTTTCTTTGGTGACTGCACAAAGTCATGTCTCCACCTGGAATTTATTATGACCTTTTTTC

ACTGTATGTACTTCATATGTCTAATATTTATTTCAAAACAAATTAAATTGTTCTTCCTTCATCTATAATGTTTTATCTAACATTTTATTGATGTAAAGTC

AAATTGTGTAATAAAAGTCTTCCTGGATTTAA
Translation
 - UNI23925 - MADTTPNGPQGAGAV - UNI23925 - - UNI35386 - QFMMTNKLDTAMWLSRLFTVYCSALFVLPLLG GLHEAASFYQR

ALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTM MSIFPVLLFSLLHAATYTKKVLD AKGSNSLPLLRSFLDKLSTNQQ

NILKFIACNEIFLMPATVFMLFS - UNI34624 - SGQGSLLQPFIYYRFLTLRYSSRRNPYCR - UNI34561 - RNLFNELRIVVEHIIMKPSC

PLFVRRLCLQSIAFISRLAPTVA
Transcript ENSMUST00000120237
Sequence
AACCCCGGGAACCGGCGGCGTCGATCGGCCCTTTAAGGCCTTTCTCCGAAGCTCCGCCTTCGCTTGGGTCTTTCTAGAAAGGCAGCTTCGGTCTGGACCG

AGCGGGGCAG - UNI23925 - CGTCCCGGGCTCCCGAGTGTCTCCCATGGCGGATACGACCCCGAACGGCCCCCAAGGGGCGGGCGCTGTG - UNI

23925 - - UNI35386 - CAATTCATGATGACCAATAAATTGGACACAGCAATGTGGCTTTCTCGCCTGTTCACAGTTTATTGCTCCGCTCTGTTCG

TTCTGCCTCTTCTTGG GTTGCATGAAGCAGCGAGCTTTTACCAGCGTGCTTTGCTGGCCAATGCTCTGACCAGCGCTCTGAGGCTGCATCAGAGATTAC

CTCACTTCCAGTTGAGCAGAGCGTTCCTGGCTCAGGCCTTGTTAGAGGACAGCTGCCACTACCTGCTGTATTCACTCATCTTCGTCAACTCCTACCCTGT

CACAA TGAGTATTTTTCCAGTCTTGTTATTTTCTTTGCTCCATGCTGCCACATACACTAAGAAGGTCCTGGAC GCAAAGGGTTCAAATAGTTTACCTC

TGTTGAGATCATTCTTGGATAAATTAAGTACTAACCAACAAAATATTCTGAAATTCATCGCTTGTAATGAAATATTCTTGATGCCTGCTACAGTTTTTAT

GCTCTTTAG - UNI34624 - TGGCCAAGGAAGTTTGCTCCAGCCTTTTATATATTATAGATTTCTTACTCTTCGATATTCCTCTAGAAGAAATCCAT

ATTGTCG - UNI34561 - GAACTTGTTTAATGAACTGAGGATTGTGGTTGAACACATTATTATGAAGCCCTCCTGCCCACTGTTTGTGAGAAGACTA

TGTCTCCAGAGCATCGCCTTTATCAGCAGACTGGCACCAACA GCTTGAAATTTCCTAGCCATGTGCAGCAGCAGTTCAGATGCCTTTGAAAGGATATGA

TTGAAGACAGCATGTGATACACTTGTATGTTCTGAAATAATGAAGAATATTCTGTAGATGCATGTTTACCCAGCAAATGTGGTTCAGAGGGTTTAATGGA

AAGGGCTATGGGTAAGGCAACTCATGGGGAATGGGCCTGGGGAGTAGTTGAGGGCAGCGATGGGTGTTTCAGCCTGGTAACGCATAGATGAGTTGGGGGG

ATTGGATGTATAATGCATCTGTGATTGAGGCTGTGTAATATGTTCAATTCTTTTCACTCAATTCTATTCCTTTATAAAAGGCATTCTGATCCTTACTACT

CACTGTTGCATGATTGGAAGTACTTAAAACACTGCACAAGTTTAATATAGAGTAATGGAATGTGGCTTTTTTTTTTAATACCCAGTTCTATCTGCATGTA

ATTTGGATTTTTCAAATACATTCATTAGTAACTTAAAACATCAGTTTTCTTTTTGTTTAAGTTACTAATCTATAGAAAGGTGATAGTCTTGGGGTAGATT

TCCAGAAAATACTACTTGATAGCTTAGCTTTAACCAGCTACTTTTATATTTTTGTAATATTTATCCACCAAGTTGGAGAAGCAACCTCATAATATCCAGT

TGATTTTTTTATGTGTGTGCCTAGCCTCCTTATCACTATGTTTTAAGAATACAACTTTGTAGAGCAATAAAGTGACTATCTTGTTATGTAAACATACTGA

TTTCTAATGATGTTTTAAAACATTGTCTTGAATGACATCAAGTTCTGGCAGCTAAAGGCATATTTATTTTGAAATGTGTTTTCTCCTACATTTTCCCCCC

TAATCTTGGAACATTTTAGATTTATAAGAACTTCAAAAATAGTGCTGAGAGTGCCTATGCACCTCTTACTTGTCTATTTTTATATTAGCGTCTTCTTTTA

ATTGGTAGGACATTTATGCAAAGTAAAATACTAACTTTGGATCAGCTAAAGTACAAGATGTGTTTGTATTTCACCAACTCTTTCATTTGTGTCGTGTGTG

CGCTGTGTTGGTACCTGGATTGCCTTTTATGTTTCAAGGCCTATAAGTGAGTTTGTTCTTTATGGTATTGGTACAGAAACTTTCCTTAGAAGAGCTAATT

CATGCTGACTTTAACATGAATTTTTTTCTTAAAATTGTAATTTCAAATGCTTAGTGATATAATTAAGACTCTTTAATGGC
Translation
 - UNI23925 - MADTTPNGPQGAGAV - UNI23925 - - UNI35386 - QFMMTNKLDTAMWLSRLFTVYCSALFVLPLLG GLHEAASFYQR

ALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTM MSIFPVLLFSLLHAATYTKKVLD AKGSNSLPLLRSFLDKLSTNQQ

NILKFIACNEIFLMPATVFMLFS - UNI34624 - SGQGSLLQPFIYYRFLTLRYSSRRNPYCR - UNI34561 - RNLFNELRIVVEHIIMKPSC

PLFVRRLCLQSIAFISRLAPT A
Transcript ENSMUST00000113680
Sequence
CCCGCCTGACTCACGTGGAAACGAAAGGATCACTTCCGGTTTTGCAACCCCGGGAACCGGCGGCGTCGATCGGCCCTTTAAGGCCTTTCTCCGAAGCTCC

GCCTTCGCTTGGGTCTTTCTAGAAAGGCAGCTTCGGTCTGGACCGAGCGGGGCAG - UNI23925 - CGTCCCGGGCTCCCGAGTGTCTCCCATGGCG

GATACGACCCCGAACGGCCCCCAAGGGGCGGGCGCTGTG - UNI23925 - - UNI35386 - CAATTCATGATGACCAATAAATTGGACACAGCAA

TGTGGCTTTCTCGCCTGTTCACAGTTTATTGCTCCGCTCTGTTCGTTCTGCCTCTTCTTGG GTTGCATGAAGCAGCGAGCTTTTACCAGCGTGCTTTGC

TGGCCAATGCTCTGACCAGCGCTCTGAGGCTGCATCAGAGATTACCTCACTTCCAGTTGAGCAGAGCGTTCCTGGCTCAGGCCTTGTTAGAGGACAGCTG

CCACTACCTGCTGTATTCACTCATCTTCGTCAACTCCTACCCTGTCACAA TGAGTATTTTTCCAGTCTTGTTATTTTCTTTGCTCCATGCTGCCACATA

CACTAAGAAGGTCCTGGAC GCAAAGGGTTCAAATAGTTTACCTCTGTTGAGATCATTCTTGGATAAATTAAGTACTAACCAACAAAATATTCTGAAATT

CATCGCTTGTAATGAAATATTCTTGATGCCTGCTACAGTTTTTATGCTCTTTAG - UNI34624 - TGGCCAAGGAAGTTTGCTCCAGCCTTTTATAT

ATTATAGATTTCTTACTCTTCGATATTCCTCTAGAAGAAATCCATATTGTCG - UNI34561 - GAACTTGTTTAATGAACTGAGGATTGTGGTTGAA

CACATTATTATGAAGCCCTCCTGCCCACTGTTTGTGAGAAGACTATGTCTCCAGAGCATCGCCTTTATCAGCAGACTGGCACCAACA GCTTGAAATTTC

CTAGCCATGTGCAGCAGCAGTTCAGATGCCTTTGAAAGGATATGATTGAAGACAGCATGTGATACACTTGTATGTTCTGAAATAATGAAGAATATTCTGT

AGATGCATGTTTACCCAGCAAATGTGGTTCAGAGGGTTTAATGGAAAGGGCTATGGGTAAGGCAACTCATGGGGAATGGGCCTGGGGAGTAGTTGAGGGC

AGCGATGGGTGTTTCAGCCTGGTAACGCATAGATGAGTTGGGGGGATTGGATGTATAATGCATCTGTGATTGAGGCTGTGTAATATGTTCAATTCTTTTC

ACTCAATTCTATTCCTTTATAAAAGGCATTCTGATCCTTACTACTCACTGTTGCATGATTGGAAGTACTTAAAACACTGCACAAGTTTAATATAGAGTAA

TGGAATGTGGCTTTTTTTTTTAATACCCAGTTCTATCTGCATGTAATTTGGATTTTTCAAATACATTCATTAGTAACTTAAAACATCAGTTTTCTTTTTG

TTTAAGTTACTAATCTATAGAAAGGTGATAGTCTTGGGGTAGATTTCCAGAAAATACTACTTGATAGCTTAGCTTTAACCAGCTACTTTTATATTTTTGT

AATATTTATCCACCAAGTTGGAGAAGCAACCTCATAATATCCAGTTGATTTTTTTATGTGTGTGCCTAGCCTCCTTATCACTATGTTTTAAGAATACAAC

TTTGTAGAGCAATAAAGTGACTATCTTGTTATGTAAACATACTGATTTCTAATGATGTTTTAAAACATTGTCTTGAATGACATCAAGTTCTGGCAGCTAA

AGGCATATTTATTTTGAAATGTGTTTTCTCCTACATTTTCCCCCCTAATCTTGGAACATTTTAGATTTATAAGAACTTCAAAAATAGTGCTGAGAGTGCC

TATGCACCTCTTACTTGTCTATTTTTATATTAGCGTCTTCTTTTAATTGGTAGGACATTTATGCAAAGTAAAATACTAACTTTGGATCAGCTAAAGTACA

AGATGTGTTTGTATTTCACCAACTCTTTCATTTGTGTCGTGTGTGCGCTGTGTTGGTACCTGGATTGCCTTTTATGTTTCAAGGCCTATAAGTGAGTTTG

TTCTTTATGGTATTGGTACAGAAACTTTCCTTAGAAGAGCTAATTCATGCTGACTTTAACATGAATTTTTTTCTTAAAATTGTAATTTCAAATGCTTAGT

GATATAATTAAGACTCTTTAATGGCATTGCAGAATTTCATTATTTCTGATAACTTGTGCATGAGTGAAAATGTATATTTGTTCCTTAAGGGAAGGTGTAA

TATAATTCTCAAGCCCATGAGAAGGCAAATTTTATAATTTGAACATTAATAGATGTTAGTTTGCATGAAGTTGCAGTTAGAAATATTATACTCTGTGTGA

ATATGTACAATCAACTGATCTCAAATCTGAAATTAGTGTTTCCATGTACACATGTCAAAAGTGAGGACATGACTAGTGCATAGAGTGGACGAGCAGGGGA

ACTTTAATACTGCGTAACCAAGCAGTTTAAAGGAAGTTGATTGATCAAGCAGAATATCTAGTGCTTTGGAAACTGGAATGGTGCTGGCGTGTTTTAAACC

TTGTTGGACAAGTGGAAGCTTCAGACAAAGTCTGTTGTTTTCTAACAAGCATTCAATTTCTACTGCATACTTCATCTCTCACCGAGTTGGCTGTAATTTA

ATAGTAATCCATAGAGCAATTTCTTAAGTATAATTTGTATTTAAATTTCCTTGAAATAAAATTTCACTAAGGGAGATGCTTTTGAAAGAAAAACAAGAGA

GAAAGCTAATTTTAAAGATTAAGTTGAGATCTTTGTATATATCCCTGACAGAGAATGTCAAGGCAAGCTAGTAACAAACCTGAAGTTCTGGGAAGTGAAT

GATGCTGTTAAATAAGAATCGCATCGTTCTCAGTCGGTATAGAGATGTAGACAGAAGTTTGAATTAGGTTTGTAAGTTTAGCGAATATCCTGGATAGGAT

CACGAATGCATATATAATAAGACAAAGCAGAAGCCAGGTATCTAAGCATTTCAGATGGGGAAGTGAGCACCTGTGATTGTAGTTTAAAAAACAAAACAAA

AACACTCAGGTAGTGTATTGGAATTTGTATTGACTAACTCACCCAGGGAGAAATTAGCTGTGGACAGTTAGGTTTAGATCGGTAAGTGTCACTGTTTCCT

TGGGTAGTCCCCATTTTCACAAGTTGGGTTAGAAGATTATGCTGTGCTACTTAAAGTGCTTAGTAGACTATAACCCTAAGTATCTTGGTTCTATGACCCC

TTTAATTCAATAGTGGACAGTTATTTGCTAAGTATTTACTATGTGTGCTGTGAGATGGGGATGGGGATTGAAGCCAGGGCCCCTTGTTCTACTACTGAGC

TATATTCCCAGCTTATGAGTACCATTTTATAACAGTAAAACATTCAAAAGAAGTGCGTTGTCAATACAAGCCAGGAAAACAGGGCCCAGTCTGGAGTGGC

GTGTGTGTTAGTGTCTCTTCTTTTCATTTTCAGCCAGTCATCCAAGTACATAAATTGTTGAGGTTATTCTTTTCCCTTTTACAAATGTTCAAAGAAATGA

TAACTTTTCTAATATAGAGAGATGGAATTTTAATTTTTTCATGATTATTTTGTAGGTACACTAGATAGAATCCGTTAAATTACAATTGAGATTTATTTTT

TCCCCTGTAATTTGAAAGCACTTGAGTGTTTGGAAACTACTATATCAGTAATGCTACCTAGGTTTGAAGATCGAGTGTAGTTCATAAAGACAACAAATTT

TCGCTCCACCATTGGAATTCCCTGGATCAGGGAAGTTCAACACTGGCAATGTGTTGGTGTAGCTCAACAGGCACTACATAGCTTTGGAAGCCCGGAGTTG

TTTCTCAGCAGCTCCTTAATGCACATGGTCTTTCATAGTTTGACTGCAAAGCCATTCTTGGAGCTGGTGTCTATCAAAGATATCAAAGGAGCTGCTGGGA

ATTTGAAAGGTTTCCTGTAATTAGTTAATCAGTGTGAATTTTGTGATTTTTGAGATGGCACTTAGGTGGCCCATTCAGAATGGATGGAATCTCGGGTAAA

GGCTTCTCTCTGTGGCCTTCTCTTTGTGATGCGCATGCCATGTACCCAGCCCACACTGAGTGTGAGTCAGTAGTGACAGACAGCATGCAGTAAGTATTCT

CTGTATCTCAAGTGGCTCTTTCTTAGAAAACCATAGGAAAAAGATTATTGATAGCTGTGTTTGCTAGAGTCTTTTAACGACGCTATTGGCTATTGTAGGA

GAAAGAAGGGCACAAGAGTCATACCCTACCTTTTCCTTCCTTCCCTCCTTCCTTCCTTCCATCCATCCATCCATCCATCCATCCCCCTGAGACGGGGTTT

CTCTTTGTAGACCTTTGAACCCAGGGATCCTCCTGTCTCTGCCTCCCATCTTTCCTAGTTTTTTAAAGGTACATTAAAAAAAATAGGCTCAGCATTTTTT

AAACTAACGTTGTTCATAACATTTAATTCCAAACGTTTACTATTTTTTGTTACTTTAAGGACAATTCCTTTTGGCACTAGTTTTTGTCTACAAGTATCTG

TAAGTTGAGACCAAAAGAGCAAACTCTTAGCCAGGCAACACTTACATTGTGTATATATTGGAACAAATATACAAGGCTTGCAGAGATTAGCAATACTCAT

AGGAACTGTTTGATTTATAACTGCATCGCTTCTGGTGCTTGATACAATGGGATCTATTGAGCTAAAAAAAATTGTATATACAGTACGTCAGCACTTCTTA

CGTCTCTTGAATCCATTTTTAATATATTGTATAGGTTGGGGAGTTATATATACTCTTCAAGCCATTATTATCCTGGCTATAAATTTATAAAATAAATTGA

AAAATTTATCACTCTCCTGTATTCAAGACCAAAGCACATAATGCTAATGTAGGGCTCAGAGGGGAAAATCTAGTTCTCCTGCATATTTGAGAAAACGTGG

AGTCCTTTCAAGAAAATGTAATAAACATAATAATCGTAGCCTGCTGACACTAAGGAAAAAGGCCTCATTCGCTCTTTCTTTTATGCAGCAATTTACTGGT

CCCTGCTGATCTTCAAATTGGATCACTGTAGTAAATTATCCACGCTGGTACTGGTGGAAGTAAGCCCTAGGATCCATATTTGTTTTGTGTTCTGCTTAAA

TCAGCAAGAATGATAAATTCGATGGTGTGAAATTGGAAGTATCAAGGGCTTTCTTTGGTGACTGCACAAAGTCATGTCTCCACCTGGAATTTATTATGAC

CTTTTTTCACTGTATGTACTTCATATGTCTAATATTTATTTCAAAACAAATTAAATTGTTCTTCCTTCATCTATAATGTTTTATCTAACATTTTATTGAT

GTAAAGTCAAATTGTGTAATAAAAGTCTTCCTGGATTTAA
Translation
GLSPKLRLRLGLSRKAASVWTERGS - UNI23925 - SVPGSRVSPMADTTPNGPQGAGAV - UNI23925 - - UNI35386 - QFMMTNKLDT

AMWLSRLFTVYCSALFVLPLLG GLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTM MSIFPVLLFSLL

HAATYTKKVLD AKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFS - UNI34624 - SGQGSLLQPFIYYRFLTLRYSSRRNPYCR

 - UNI34561 - RNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPT A

For any suggestions or comments, please send an email to unitrap@crg.es