Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037742 (Eef1a1)
Chromosomal location
Chr 9: 78326265 - 78329478 (-)
Description
eukaryotic translation elongation factor 1 alpha 1 Gene [Source:MGI (curated);Acc:Eef1a1-001]
RefSeq_dna
NM_010106 
RefSeq_peptide
NP_034236.2 
UniGene
Mm.311918 Mm.335315 Mm.360075 Mm.447803 Mm.468920 Mm.468942 Mm.469246 Mm.476158 
MGI
MGI:1096881 
Uniprot/SWISSPROT
P10126 
Uniprot/SPTREMBL
Q3TII3 Q3UA81 Q3UZQ3 Q4FZE5 Q58E64 
Human Ortholog
ENSG00000156508 (EEF1A1)
Omim not available
UniTrap UNI22301
Vector Insertion
Chr 9: 78328496 - 78329445
Public Clones PST22671-NR (escells) IST14183F10 (tigm)
Private Clones OST301237 (lexicon) OST266489 (lexicon) OST262135 (lexicon) OST240552 (lexicon)
OST182027 (lexicon) OST110549 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12389
Vector Insertion
Chr 9: 78328228 - 78328317
Public Clones M025C08 (ggtc) PST7402-NR (escells) PST12483-NR (escells) PST21269-NR (escells)
PST7455-NR (escells) PST16629-NR (escells) PST13362-NR (escells)
Private Clones OST315258 (lexicon) OST234588 (lexicon) OST171013 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18470
Vector Insertion
Chr 9: 78327956 - 78328047
Public Clones PST26012-NR (escells) PST17807-NR (escells)
Private Clones OST422831 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19318
Vector Insertion
Chr 9: 78327582 - 78327658
Public Clones P119B05 (ggtc)
Private Clones OST395436 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15193
Vector Insertion
Chr 9: 78327084 - 78327582
Public Clones PST4740-NR (escells) PST10639-NR (escells) PST10698-NL (escells) PST7646-NL (escells)
PST11021-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI674
Vector Insertion
Chr 9: 78326666 - 78326764
Public Clones DC0383 (sanger) XE690 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042235
Sequence
CTTTTTCGCAACGGGTTTGCCGTCAGAACGCAG - UNI22301 - GTGTTGTGAAAACCACCGCTAATTCAAAGCAAAAATGGGAAAGGAAAAGACTC

ACATCAACATCGTCGTAATCGGACACGTAGATTCCGGCAAGTCCACCACAACCGGCCACCTGATCTACAAATGTGGTGGAATCGACAAGCGAACCATCGA

AAAGTTTGAGAAGGAGGCTGCTGAG - UNI12389 - ATGGGAAAGGGCTCCTTCAAGTACGCCTGGGTCTTAGACAAACTGAAAGCTGAGCGTGAGC

GTGGTATCACTATTGACATCTCCCTGTGGAAATTCGAGACCAGCAAATACTATGTGACCATCATTGATGCCCCAGGACACAGAGACTTCATCAAAAACAT

GATTACAGGCACATCCCAG - UNI18470 - GCTGACTGTGCTGTCCTGATTGTTGCTGCTGGTGTTGGTGAATTTGAAGCTGGTATCTCCAAGAACG

GGCAGACCCGCGAGCATGCTCTTCTGGCTTACACCCTGGGTGTGAAACAGCTGATTGTTGGTGTCAACAAAATGGATTCCACCGAGCCACCATACAGTCA

GAAGAGATACGAGGAAATCGTTAAGGAAGTCAGCACCTACATTAAGAAAATTGGCTACAACCCTGACACAGTAGCATTTGTGCCAATTTCTGGTTGGAAT

GGTGACAACATGCTGGAGCCAAGTGCTAAT - UNI15193 - - UNI19318 - ATGCCTTGGTTCAAGGGATGGAAAGTCACCCGCAAAGATGGCA

GTGCCAGTGGCACCACGCTGCTGGAAGCTTTGGATTGTATCCTACCACCAACTCGTCCAACTGACAAGCCCCTGCGACTGCCCCTCCAGGATGTCTATAA

AATTGGAG - UNI15193 - GCATTGGCACTGTCCCTGTGGGCCGAGTGGAGACTGGTGTTCTCAAGCCTGGCATGGTGGTTACCTTTGCTCCAGTCA

ATGTAACAACTGAAGTCAAGTCTGTTGAAATGCACCATGAAGCTTTGAGTGAAGCTCTTCCTGGGGACAATGTGGGCTTCAATGTAAAGAACGTGTCGGT

CAAAGATGTTAGACGAGGCAATGTTGCTGGTGACAGCAAAAACGACCCACCAATGGAAGCAGCTGGCTTCACTGCTCAG - UNI15193 - GTGATTA

TCCTGAACCATCCAGGCCAAATCAGTGCTGGCTACGCTCCTGTTCTGGATTGTCACACAGCCCACATAGCATGCAAGTTTGCTGAGCTTAAAGAAAAGAT

CGATCGTCGTTCTGGTAAGAAGCTGGAAGATGGCCCCAAGTTCCTGAAGTCTGGCGATGCTGCCATTGTTGATATGGTCCCTGGCAAGCCCATGTGTGTT

GAGAGCTTCTCTGACTACCCTCCACTTG - UNI674 - GTCGCTTTGCTGTTCGTGACATGAGGCAGACAGTTGCTGTGGGTGTCATCAAAGCTGTGG

ACAAGAAGGCTGCTGGAGCTGGCAAAGTCACCAAGTCTGCCCAGAAAGCTCAGAAGGCTAAATGAATATTACCCCTAACACCTGCCACCCCAGTCTTAAT

CAGTGGTGGAAGAACGGTCTCAGAACTGTTTGTCTCAATTGGCCATTTAAGTTTAATAGTAAAAGACTGGTTAATGATAACAATGCATCGTAAAACCTTC

AGAAGGAAAGAATGTTGTGGACCATTTTTTTTGTGTGTGGCAGTTTTAAGTTATTAGTTTTCAAAATCAGTACTTTTTAATGGAAACAACTTGACCAAAA

ATCTGTCACAGAATTTTGAGACCATTAAAACAAGTTTAATG
Translation
 - UNI22301 - MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAE - UNI12389 - MGKGSFKYAWVLDKLKAERERGIT

IDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ - UNI18470 - ADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDST

EPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSAN - UNI15193 - - UNI19318 - MPWFKGWKVTRKDGSASGTTLLEA

LDCILPPTRPTDKPLRLPLQDVYKIGG - UNI15193 - GIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVS

VKDVRRGNVAGDSKNDPPMEAAGFTAQ - UNI15193 - VIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIV

DMVPGKPMCVESFSDYPPLG - UNI674 - GRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

For any suggestions or comments, please send an email to unitrap@crg.es