Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037750 (BC017647)
Chromosomal location
Chr 11: 77908214 - 77970839 (+)
Description
Uncharacterized protein C17orf63 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q6P539]
RefSeq_dna
NM_145430 
RefSeq_peptide
NP_663405.1 
UniGene
Mm.119387 
MGI
MGI:2384939 
Uniprot/SWISSPROT
Q6P539 
Human Ortholog
ENSG00000173065 (C17orf63)
Omim not available
UniTrap UNI563
Vector Insertion
Chr 11: 77908294 - 77929127
Public Clones BC0585 (sanger) BB0074 (sanger) BB0204 (sanger) BC0021 (sanger)
BC0014 (sanger) CSG006 (baygenomics) RRS701 (baygenomics) (ggtc)
E126D02 (ggtc) IST14472C6 (tigm) IST10007G2 (tigm) IST14513H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16325
Vector Insertion
Chr 11: 77929340 - 77956594
Public Clones (sanger) IST10906F2 (tigm) IST10070H6 (tigm)
Private Clones OST463135 (lexicon) OST430031 (lexicon) OST390314 (lexicon) OST389083 (lexicon)
OST370915 (lexicon) OST348464 (lexicon) OST317815 (lexicon) OST309673 (lexicon)
OST294855 (lexicon) OST278543 (lexicon) OST277247 (lexicon) OST265315 (lexicon)
OST240563 (lexicon) OST230815 (lexicon) OST209232 (lexicon) OST172876 (lexicon)
OST147354 (lexicon) OST146490 (lexicon) OST145056 (lexicon) OST139818 (lexicon)
OST135200 (lexicon) OST98153 (lexicon) OST90075 (lexicon) OST81461 (lexicon)
OST68306 (lexicon) OST59025 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4541
Vector Insertion
Chr 11: 77956717 - 77967198
Public Clones AN0276 (sanger) AN0277 (sanger) (sanger) E049F10 (ggtc) P024H02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27176
Vector Insertion
Chr 11: 77967198 - 77969550
Public Clones not available
Private Clones OST67755 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073705
Sequence
GAGAGGCTGGGGCGTGGAGCAGCAGTGGCGGCGACCGGCGACAACGGAGCAGCCATGAGGGCCGGGCCCAGTCACCGACA - UNI563 - - UNI163

25 - TGTGAGCCACTGCTTCATGTTGTGCTGATGCTGGTCTGCCATGCTAGCCTGTCTCCCAGGACCAGGTGACCTGTCCCTTCAGCTTCTTTCTCACA

CGCAGATGAACACTGGACTTCAGAAAT - UNI4541 - - UNI27176 - GGGACACTACACAGAAAATGAGAACTGCTCACTATCCCACCCCAGCC

GAATTGGACGCGTATGCTAAGAAGGTCGCAAACAACCCACTGACTATAAAAATCTTCCCCAACAGTGTGAAGGTTCCCCAGCGGAAACACGTTCGTCGTA

CTGTGAACGGCCTCGACACATCAGCCCAGCGCTACAGCCCCTACCCGACTCAGGCCGCCACCAAGGCAGGCCTGCTTGCCATTGTCAAAGTGCCAGCCAA

AAGCATACTCAAGGACTTTGACGGCACCCGAGCTCGGTTCCTCCCTGAGGCCATCATGAACCCCCCAGTGGCACCCTATGCTACTGTGGCACCCAGCACT

TTAGCCCACCCACAGGCCCAGGCTCTGGCCCGCCAGCAGGCTCTGCAGCATGCACAGACCCTGGCCCATGCCCCTCCCCAGACACTGCAACACCCTCAGG

GTATACCACCACCACAGGCACTGTCTCACCCTCAGAGCCTCCAGCAGCCTCAGGGCCTGGGCCACCCTCAGCAGATGGCCCAAACCCAGGGCTTGGTCCA

CCCTCAGGCCCTGACTCATCAGGGTCTCCAGCACCCCCCTAATCCCTTGCTGCATGGAGGCCGGAAGATGCCAGACTCAGATGCACCCCCGAATGTGACC

GTGTCTACCTCAACTATCCCCCTTTCAATGGCGGCCACCCTGCAACACAGCCAGCCCCCGGACCTGAGCAGCATTGTGCACCAGATCAACCAGTTTTGCC

AGACGAGGGCAGGCATCAGCACTACCTCAGTGTGTGAGGGCCAGATCGCCAACCCCAGCCCTATTAGTCGCAGTCTGCTCATCAATGCAAGCACCCGGGT

GTCGACCCACAGCGTCCCCACACCAATGCCTTCATGTGTGGTCAATCCCATGGAGCACACCCACGCGGCCACAGCCGCACTGCCTGCTGCAGGTCCTGTC

AACCTGCCCACAGGCATCTCTCGAGCCCCCACTGGCTACCCTAGCGACCTCAAGCCAGTTACCTGGAACCAGCACCAGCTGGCTCACCTACAACAGATGT

GCAGCGAGGCCGGTGGGACGCCAGCCCCTGGCCTGACAGGCAAACATACAGCAGGACGTGAGTTGGCAGGGCCTGGTTTTGTGGGCAAGGCCGCTGCCTA

CCCACAGGAACTCTGCCTGGCACAGTCCTTCCATCTGAAGCCACCCCTGGAGAAGCCGACCCCATCCCCACCGGTCAACGGCCTACCAGCCCCACTGGCC

TACCCGAATGGCCACTACTTCCAACCCCTGTGGAACAACATTCTACCAACTCCCAATAGCGACAGCTCGGGGTCTCAAGACCTAACCATGCCATTCCATG

GTGGGCAGCCCACGGGTGCACCCCTCGACTGTGGGGCAGCTCCTGGGGCCCACTACCGAGCAGGGACTGGGGGTGGTCCAGTGGCAAGCCAGAACAGCTT

GATGCAAACGGTGGATTACCTGAGTGGGGATTTCCAGCAGGCCTGCTTCCGAGAACAGAGCCTGGCCATGTTGAGCAAAGCCCACCGAGCTCCTGGCACC

CGAGCCCCTGATCCCACAGATAGTCGAAGTCTTCATATTCAGCACCCAGGGTATAGATAGGGAGCCGGGACGCTCTCCTCAGGCAACACACATTGCCCTT

CTAGGTTTAGTCTTACTTTTAAGTAACTGGATAGTTTCAAAGCTTCCCTGCTCCAGTGTGATCATCCTGAGATGTCTAAGGAAGGGAACTTGGCCGGGTC

GATTTGGGGGCAGAAGAAGGTCCTTTATCCTTCCCTCAAGCAACTCTTGGTTTCCTGTTAGATCCTAACCCTGTCTTCTCAGCAGCTGTCTGTCAGGCAG

TCTCCACCCTGACCACTTCTGACTCTCGCCATCTTTTGCTAAACATCTATTTCTTTGGGGACTAAGTTATGACTGAGGGGAGTGGCCTAGGCCCTTAAGG

TAGGCTTCTCGGTCTGGGACTAAGAAACCAGACTTCCTAAGTGCTCTGGAAGCTAATTCCGTATGTCCCCCAAAGATCAGCATAAAGGCACTCCGCCGTC

TCTCCCAAGCCCTCAGGGCTTGGTGCTCATTTCTGTTGTTCTCAAGCCACTGCTCTTGTCCCTGCCAAAGCCTTGCGACTCAGAGAAAACCATTGCATTG

GCATCTTGGTTCTTGACTCTCCTTTGCAGAGAAATGCAGTGGCCATCTGGCATTCCCAGGACCTCCTGTCACCGTTGCCTCTGTCCAAACTCAGCTATTG

TCCTCAATCCTGCCTACCCTCCCTCCTAAGAGAAACAAACCAGAAACTACCTTACTTGAAGAATTAGTTCTAGGTAAAGGATGATCACACTAGAGTTTGG

AATTAAAAACACCAAAAAAGTTTGAAAAAAAAAAGTTTAAAAATGCATTTGGTTCTCTACACTGGCTAAGAATCACTGGTCCACACTGTAAGTTCTAATG

TCGTGTCTCTGTATGAATGAGTGGTTTGAGGAGCATTGTGTATGAGTGCCCCACAGGTACAGTCACCCTCTAAGTTTTGCAGCCCTTCAGTTTAATGAAG

AACAAAAGGAAAAACACAAAGCCTTAAGCCCCTTCAATTCCTCCTCCACCAAACGTGCGTGGTTCCGACCGCTGCAGAGGGGCTTACATTGGGAATGGCC

CCTCTTGCCCCTCACCCATTCAAGAGCATCTTCCACCTGTTCCAGGACCAATGTGTCTCATTCCCAAGTGGCAATTAGTTGTCTAGAAATTCAACACTTC

TCTGTAACGTTAGACTGTTTTGTTGTAAATTCTTGCACCTGTCTTCTGTTGCACAGTTGGGCTTTGAAAGTAATAGTACTAAGCCCTTGCCTTTCCTCGC

CTTGGGGGAATGTGAGCTGATAACTGAAGGTCTGGGGTTTATTCTCACTGTTCCTTAGCCAGAAATTCTGTAGTGATCTGAAGCAATGTGACTGAAGACC

AGTTTTTAAATTATGTGTTGGCAAGTTGCCTTATATTTAAAAGAAGGAAAAAAAAAAGGAAAAATGCCTGCGTGTGTTATGCCAAATGATAGCAACACGA

AGTCCTAATTTATTGTTTCCTTGCTGTCTGAGCACTGGTATCACTGTCCTGTCCCCGAGCCCCTCAGCTTCTGGTGCAATGCCTCCTCCGGGGTATTGGC

CGCCTCACCCAGGCACCTCCGCTAGCCACTTATTTGAAGAGCTCTACTCTCTCCTTTGACCTCCAACCTGACATTGTAACCCCAAATTCTCCTTCCTAGG

GGGCTGCCACTGTAGGAAACTGGACCAAACACCGACTTGGGGGCTTTCACACCTCACCCCCACCTCTAGTCTGCATGGAAATTGTACTGTGATTCCCTTA

CCCTGCAAATGACTGCCCCCAACTTTGGTGTAAGGTGTTTCCTCGTTCAGCCTGATTGTCTCCCACCCCACCCCAGCCAATCCCCAACCAGCAATAAGGG

TCCAAGCAATAAGGGCCTCATATCTACATTCCTTGCCTCCAAAATCCCATGCCACCCCAAAGGAAACCCTGGACTCCCCGACTTTCCACATACTGTAGCA

TCTGGTCTCCATCTCTCACCTTACCTGTGGTGGTTTATGGGCATGGTGGAATTTTTTTTTTTTTTAAGATTATTATAAAGCAGTAAAACACACC
Translation
 - UNI563 - - UNI16325 - MLACLPGPGDLSLQLLSHTQMNTGLQKW - UNI4541 - - UNI27176 - WDTTQKMRTAHYPTPAELDAY

AKKVANNPLTIKIFPNSVKVPQRKHVRRTVNGLDTSAQRYSPYPTQAATKAGLLAIVKVPAKSILKDFDGTRARFLPEAIMNPPVAPYATVAPSTLAHPQ

AQALARQQALQHAQTLAHAPPQTLQHPQGIPPPQALSHPQSLQQPQGLGHPQQMAQTQGLVHPQALTHQGLQHPPNPLLHGGRKMPDSDAPPNVTVSTST

IPLSMAATLQHSQPPDLSSIVHQINQFCQTRAGISTTSVCEGQIANPSPISRSLLINASTRVSTHSVPTPMPSCVVNPMEHTHAATAALPAAGPVNLPTG

ISRAPTGYPSDLKPVTWNQHQLAHLQQMCSEAGGTPAPGLTGKHTAGRELAGPGFVGKAAAYPQELCLAQSFHLKPPLEKPTPSPPVNGLPAPLAYPNGH

YFQPLWNNILPTPNSDSSGSQDLTMPFHGGQPTGAPLDCGAAPGAHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGTRAPDP

TDSRSLHIQHPGYR
Transcript ENSMUST00000100782
Sequence
GTAGGCGCACCGCGGAGTGCAGCGCTCTCGGTGAGCCTGGCACCCGGAGTAGCCGTCTCCCCCTCCCCCTGCCTCAGCCTATAGAAGCCCTCTCTCTTCT

GTCCTCCCTGGTCTGGGGCAAGCAGGGCTGCACTGTCCCAGGCCGGCGGGGCGGAGCCCGGAGCCCCACTGAGAGCTGCAGAGCCAACATCACCTCCTGC

CCAGGGCGCAAG - UNI16325 - TGTGAGCCACTGCTTCATGTTGTGCTGATGCTGGTCTGCCATGCTAGCCTGTCTCCCAGGACCAGGTGACCTGT

CCCTTCAGCTTCTTTCTCACACGCAGATGAACACTGGACTTCAGAAAT - UNI4541 - - UNI27176 - GGGACACTACACAGAAAATGAGAACT

GCTCACTATCCCACCCCAGCCGAATTGGACGCGTATGCTAAGAAGGTCGCAAACAACCCACTGACTATAAAAATCTTCCCCAACAGTGTGAAGGTTCCCC

AGCGGAAACACGTTCGTCGTACTGTGAACGGCCTCGACACATCAGCCCAGCGCTACAGCCCCTACCCGACTCAGGCCGCCACCAAGGCAGGCCTGCTTGC

CATTGTCAAAGTGCCAGCCAAAAGCATACTCAAGGACTTTGACGGCACCCGAGCTCGGTTCCTCCCTGAGGCCATCATGAACCCCCCAGTGGCACCCTAT

GCTACTGTGGCACCCAGCACTTTAGCCCACCCACAGGCCCAGGCTCTGGCCCGCCAGCAGGCTCTGCAGCATGCACAGACCCTGGCCCATGCCCCTCCCC

AGACACTGCAACACCCTCAGGGTATACCACCACCACAGGCACTGTCTCACCCTCAGAGCCTCCAGCAGCCTCAGGGCCTGGGCCACCCTCAGCAGATGGC

CCAAACCCAGGGCTTGGTCCACCCTCAGGCCCTGACTCATCAGGGTCTCCAGCACCCCCCTAATCCCTTGCTGCATGGAGGCCGGAAGATGCCAGACTCA

GATGCACCCCCGAATGTGACCGTGTCTACCTCAACTATCCCCCTTTCAATGGCGGCCACCCTGCAACACAGCCAGCCCCCGGACCTGAGCAGCATTGTGC

ACCAGATCAACCAGTTTTGCCAGACGAGGGCAGGCATCAGCACTACCTCAGTGTGTGAGGGCCAGATCGCCAACCCCAGCCCTATTAGTCGCAGTCTGCT

CATCAATGCAAGCACCCGGGTGTCGACCCACAGCGTCCCCACACCAATGCCTTCATGTGTGGTCAATCCCATGGAGCACACCCACGCGGCCACAGCCGCA

CTGCCTGCTGCAGGTCCTGTCAACCTGCCCACAGGCATCTCTCGAGCCCCCACTGGCTACCCTAGCGACCTCAAGCCAGTTACCTGGAACCAGCACCAGC

TGGCTCACCTACAACAGATGTGCAGCGAGGCCGGTGGGACGCCAGCCCCTGGCCTGACAGGCAAACATACAGCAGGACGTGAGTTGGCAGGGCCTGGTTT

TGTGGGCAAGGCCGCTGCCTACCCACAGGAACTCTGCCTGGCACAGTCCTTCCATCTGAAGCCACCCCTGGAGAAGCCGACCCCATCCCCACCGGTCAAC

GGCCTACCAGCCCCACTGGCCTACCCGAATGGCCACTACTTCCAACCCCTGTGGAACAACATTCTACCAACTCCCAATAGCGACAGCTCGGGGTCTCAAG

ACCTAACCATGCCATTCCATGGTGGGCAGCCCACGGGTGCACCCCTCGACTGTGGGGCAGCTCCTGGGGCCCACTACCGAGCAGGGACTGGGGGTGGTCC

AGTGGCAAGCCAGAACAGCTTGATGCAAACGGTGGATTACCTGAGTGGGGATTTCCAGCAGGCCTGCTTCCGAGAACAGAGCCTGGCCATGTTGAGCAAA

GCCCACCGAGCTCCTGGCACCCGAGCCCCTGATCCCACAGATAGTCGAAGTCTTCATATTCAGCACCCAGGGTATAGATAGGGAGCCGGGACGCTCTCCT

CAGGCAACACACATTGCCCTTCTAGGTTTAGTCTTACTTTTAAGTAACTGGATAGTTTCAAAGCTTCCCTGCTCCAGTGTGATCATCCTGAGATGTCTAA

GGAAGGGAACTTGGCCGGGTCGATTTGGGGGCAGAAGAAGGTCCTTTATCCTTCCCTCAAGCAACTCTTGGTTTCCTGTTAGATCCTAACCCTGTCTTCT

CAGCAGCTGTCTGTCAGGCAGTCTCCACCCTGACCACTTCTGACTCTCGCCATCTTTTGCTAAACATCTATTTCTTTGGGGACTAAGTTATGACTGAGGG

GAGTGGCCTAGGCCCTTAAGGTAGGCTTCTCGGTCTGGGACTAAGAAACCAGACTTCCTAAGTGCTCTGGAAGCTAATTCCGTATGTCCCCCAAAGATCA

GCATAAAGGCACTCCGCCGTCTCTCCCAAGCCCTCAGGGCTTGGTGCTCATTTCTGTTGTTCTCAAGCCACTGCTCTTGTCCCTGCCAAAGCCTTGCGAC

TCAGAGAAAACCATTGCATTGGCATCTTGGTTCTTGACTCTCCTTTGCAGAGAAATGCAGTGGCCATCTGGCATTCCCAGGACCTCCTGTCACCGTTGCC

TCTGTCCAAACTCAGCTATTGTCCTCAATCCTGCCTACCCTCCCTCCTAAGAGAAACAAACCAGAAACTACCTTACTTGAAGAATTAGTTCTAGGTAAAG

GATGATCACACTAGAGTTTGGAATT
Translation
 - UNI16325 - MLACLPGPGDLSLQLLSHTQMNTGLQKW - UNI4541 - - UNI27176 - WDTTQKMRTAHYPTPAELDAYAKKVANNPLTI

KIFPNSVKVPQRKHVRRTVNGLDTSAQRYSPYPTQAATKAGLLAIVKVPAKSILKDFDGTRARFLPEAIMNPPVAPYATVAPSTLAHPQAQALARQQALQ

HAQTLAHAPPQTLQHPQGIPPPQALSHPQSLQQPQGLGHPQQMAQTQGLVHPQALTHQGLQHPPNPLLHGGRKMPDSDAPPNVTVSTSTIPLSMAATLQH

SQPPDLSSIVHQINQFCQTRAGISTTSVCEGQIANPSPISRSLLINASTRVSTHSVPTPMPSCVVNPMEHTHAATAALPAAGPVNLPTGISRAPTGYPSD

LKPVTWNQHQLAHLQQMCSEAGGTPAPGLTGKHTAGRELAGPGFVGKAAAYPQELCLAQSFHLKPPLEKPTPSPPVNGLPAPLAYPNGHYFQPLWNNILP

TPNSDSSGSQDLTMPFHGGQPTGAPLDCGAAPGAHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGTRAPDPTDSRSLHIQHP

GYR

For any suggestions or comments, please send an email to unitrap@crg.es