Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037808 (2810485I05Rik)
Chromosomal location
Chr 9: 13632214 - 13650973 (+)
Description
RIKEN cDNA 2810485I05 gene Gene [Source:MGI Symbol;Acc:MGI:1920076]
RefSeq_dna
NM_176836 
RefSeq_peptide
NP_789806.1 
UniGene
Mm.246174 Mm.392917 Mm.472213 
MGI
MGI:1920076 
Uniprot/SWISSPROT
Q80XP8 
Uniprot/SPTREMBL
A6X915 
Human Ortholog
ENSG00000077458 (FAM76B)
Omim not available
UniTrap UNI28334
Vector Insertion
Chr 9: 13633269 - 13634168
Public Clones CMHD-GT_242F6-3 (cmhd)
Private Clones OST33646 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36904
Vector Insertion
Chr 9: 13634224 - 13635425
Public Clones 3SE286D10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35147
Vector Insertion
Chr 9: 13644186 - 13648472
Public Clones IST12742A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059579
Sequence
GTCTCCCTCCGCCGCGGTCCGGGCCTAAACGGGAGCGGCGGGGCGGGCGGCAGTAGGTGTCCCGGGACGGCGGCGGAGGCGGAGGGAGACGCAGGGGACC

CGGCAGTTACCGGGACTGGGCCACAGCAGCAGAAGAGCCCGCGGGCGGGGCAGCCGAGTTCCCGGAGGCCCCGCCTGAGCGCGCGCGGAGGAGCCGGAAA

GCAGGATGGCGGCGTCGGCCTTGTACGCCTGCACCAAGTGCACGCAGCGCTACCCCTTCGAGGAGCTCTCGCAGGGCCAACAGCTCTGCAAG GAATGTC

GGATTGCACATCCTATTGTAAAATGTACTTACTGCAGATCAGAATTTCAGCAGGAGAG - UNI28334 - TAAAACTAACACAATTTGTAAGAAGTGT

GCTCAAAATGTCAAGCAATTTGGAACA - UNI36904 - CCTAAGCCTTGTCAGTACTGTAACATAATTGCAGCATTTATTGGTACCAAGTGTCAGCG

TTGTACAAATTCAGAAAAGAAATATGGAGCACCTCAGACCTGTGAGCAGTGCAAACAGCAGTGTGCTTTTGATCGCAAGGAGGAAGGAAGAAGGAAA GT

TGATGGGAAGTTGCTGTGCTGGCTCTGCACCTTGTCATACAAGAGAGTTTTACAGAAGACAAAAGAACAGAGGAAGAGTTTGGGGTCTTCACATTCTAAC

TCCTCATCTTCATCTCTTACTGAGAAAGACCAGCACCATTCTAAACACCACCACCACCACCACCATCACCATCACCGCCACAGCAGTGGCCACCACAA A

GTCAGCAGTCTAAGTCCTGAGCAGGAGCAGGGACTGTGGAAACAGAG CCATAAATCCTCTGCAGCAATTCAGAATGAAACTCCAAAGAAAAAGCCCAAG

TTGGAATCTAAGCCATCTAATGGAGATAG TAGCTCTATAAATCAGTCAGCAGATAGTGGGGGAACAGACAATTTTGTCCTTATCAGTCAACTGAAAGAA

GAAGTGATGTCACTTAAACGTCTCTTACAGCAAAGAGACCAGACTATTTTGGAAAAAGATAAAAAG TTAACTGAACTGAAGGCAGACTTTCAATACCAA

GAGTCAAATTTGAGGACTAAGATGAACAGTATGGAAAAAGCGCACAAAGAAACTGTGGAACAACTCCAG - UNI35147 - GCCAAAAACAGAGAACT

ACTCAAACAGGTTGCAGCCTTGTCTAAGGGTAAAAAGTTTGACAAGAGTGGAAGCGTGCTAACATCTCCCTGAAAAAGTCACTTGTTTAGCATTTCTGCC

CAACAGTGTGTACTTGAGGTGTCCTGTGACACCCTTAGATTCTGTGCAGTGGAAAGATATTTTTACATGCCAAATTAATTGGTATGTCTCCTATTCACTT

TTGTAACTTACACACAGCATTTTTTAAGTTGTAAACATGCAGATAAAACTTCAGCTGGCTTGGAGTGACTTCTTAATTCTTTGATACCGGAACTTTTTTC

TAGCAATAGTATTGATGGTGTGGAGTGCACAGGTGCACTGTGTAAAATGCAACATGCAATAATGGAGTGGCTGGCAGAGCAGCAGCAGGGGTGGGGCTTT

GCGTTTGTTTAACACTATGCTGTTTTCAAATAAATAGTTTTCCATTTAGAAATGCAAAACTTTTAAACAAGGAAAATGATGGTGAACACTGTTTTTTTGG

GAATTGTATTTTTACTTCACATCAACATGAATTTAGAGAATCATGGTGCTTTTATTAAAAGAGCTTCAGAGTATATGTAAATACGTTTTTAAAAGTCACG

TCGCTGATATCAGTTAGGTAACCTAACATTTCACTACTGCTCTAGGATTGATGTGCACTGTACAGCATCCGAGGTAAAACGTGGTTTTGTTTTGTAAAAA

CTGTAGATTTTTACTTACAAGTGCCTTTTTGCCACCTAATGTTTTTATTTATAGGAATGCTGATCTTTTGTACATATGGTTTGTTTTAAAATCATGTTAA

TAAGTTTGTATATAAGTGCATATGTATATAACCGGATTTCAAAAAGAAATCAAAGTTATTAGTAACATGCAAGATTGCATATTAAGAATTAACTGATAAA

TGCATATAGACTTTAGGTGATTTTGTGGTTTGCTGCTGTATCATAAGGGAAGCTGTTGGTCATTGAGTTCATTTAATTATGTTGGAATACTTTCCTAAAG

ATTTAATTTTAACTCCATTTTGATAGAGTGATTTTATTTTTATGTTGTGTGGCTTCGTGTTTATATTTTGTGAGTTACATGTTTTGCTTTATTTTTATAT

AAAATTTCTTTAAAATTTATAACGTTTCTATAACAGCCCATATATCTGCTTTTTTATAATGTGTTCTAAGTTAATATTTATGTACACCATACTTACTTTG

TAAATTTAATACAAATCTGGAAAATTAAATAACTTTTATAATCAAATCCGTGCTTATGTCTGAATAATTGAAATCTGTAAGATTCAGACACTATTTATAA

GTAATTTGCCTCAAAAGAATAAAATTGTCTATAAAAGGTTAACATAGTGTGGGATAGATTCTGAGAAATTACAGATCAGCTTCTGATGTTAGTTCTGGCT

TCAAGGTGAATTCTAAACCTTCAGGCACTGCTGGCCACACCATATGACTTCTTTCTCTTAGGAATGTGCAGTTACACTTGTTTTCATCAGTCCTGAAAGG

TTTATTTTTAGAGAATTGTTTATATGGTCTTCATATCAAAGATTAGTGTTAAGAATACATATAACAATTCATTTTAAATTACTCAGGTTTTAGTAAACTT

CCCACAGTAGTTTGCTACAAGTGAAAGGAAATCTACAAGTTCAGAAAGACCTCATTTTCAAGTGACAGTAAGATTGAATTAGTCAGCTTTGGTAAGAGTC

AGCTGTGTGCTGTCCTGGGGCCTCAGAAGCACACTCGCTCGCTCACTGTTTTCCACTTTGGTAGACAATGCCTTACTGTGGGGATTCCTGTCTGCAGGAT

CTGCTGCATTCATAAAGTCCTTATTACATTGCTTTACGTTTTGTTTGATTACAGTTTCTTGGCCAGTTTTCAATCCACAGTAGTCATAATTCTAAATGAA

CTACAGTAGTTCTGATACCTTGCTGGAGAAGATAGAAACAGAATCCCTCCTCCCCTTTTTAGCTAACATGGAAATTGGAAATCAGTTTAAAATAGTGAAG

CTTTGTAAAGTGCAAGGCTAAAACTAAAATTTAGGACTTTACAGTATTCAGCCCTAATCAGACATACTCTTTATTCCATAACTTTATTTTATAACTTAAA

TTTTTTTTGCAATTGTATAAATTAGTGATTGAGTCTCAGTCCCAGATCTGTAGTGTATTGATCTAATGAATTGATACTCTTTAAACGTGGACCTGTCCAG

AGGTACTATGGTGTGCTGTATTGTGCTTTTAGCCTGTTTGCTGCAGTTAGCATATCCCAGTGAGGGTCATATAGACTCCAGTTTATCATGTATTAATAGC

CTGTGAATATTACAGTCATTTTTAGAGTATATTGGTCTAAATATGCATTTTCCGATGAGCCTGTTAAGCTGGTCACATGTATAGATTAACAAAATACTGT

ACCTGTATACATCTGACTGTTGGCATTTTGTACTTTTTTCTAAGCCAATATTTCACAATAAAATATGCCGAAAGCTTTGTGTTG
Translation
MAASALYACTKCTQRYPFEELSQGQQLCK ECRIAHPIVKCTYCRSEFQQES - UNI28334 - SKTNTICKKCAQNVKQFGT - UNI36904 - P

KPCQYCNIIAAFIGTKCQRCTNSEKKYGAPQTCEQCKQQCAFDRKEEGRRK VDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSSSSSLTEKDQHHS

KHHHHHHHHHHRHSSGHHK KVSSLSPEQEQGLWKQS SHKSSAAIQNETPKKKPKLESKPSNGDS SSSINQSADSGGTDNFVLISQLKEEVMSLKRLL

QQRDQTILEKDKK LTELKADFQYQESNLRTKMNSMEKAHKETVEQLQ - UNI35147 - AKNRELLKQVAALSKGKKFDKSGSVLTSP

For any suggestions or comments, please send an email to unitrap@crg.es