Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037846 (Rtkn2)
Chromosomal location
Chr 10: 67442318 - 67521903 (+)
Description
rhotekin 2 Gene [Source:MGI (curated);Acc:Rtkn2-001]
RefSeq_dna
NM_001081346 
RefSeq_peptide
NP_001074815.1 
MGI
MGI:2158417 
Uniprot/SWISSPROT
Q14B46 
Uniprot/SPTREMBL
Q8BFP5 Q8BFP6 Q8BFP7 Q923H9 B2RY47 
Human Ortholog
ENSG00000182010 (PLEKHK1)
Omim not available
UniTrap UNI20577
Vector Insertion
Chr 10: 67442561 - 67450054
Public Clones not available
Private Clones OST358254 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32305
Vector Insertion
Chr 10: 67489398 - 67498536
Public Clones IST15083C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35456
Vector Insertion
Chr 10: 67504126 - 67505353
Public Clones IST10064G2 (tigm) IST12902F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117086
Sequence
GCAATCTGCAGCTGCAGCCCTGGGGCGCGCTTTTCAAATCGGCCGTGCCTTGCACCGAGATGGAGGGGCAGCTGCTGAGGGGTCTCGCCGCGCAGCAG -

 UNI20577 - GACTGCAGCATCCGAGAGAAAATAGACTTAGAGATCCGCATGCGAGAAGGAATATGGAAGCTGCTCTCGCTGAGTACGAAAAAAGACC

AAGTTTTGCATGCAGTTAAGAACCTCATGGTGTGCAGTGCTCGGATCCAGGCGTACACGGCAGAGCTGCAGAAGTCAAAAGAAGAGATTGCAAATCAAAC

CGGAGCACG GGATTCGAGTTCTGAAAATAAAGAAGGAGAATCCTGCAGAGGAAAGATCGCCCTGTCAG ATATCCGAATACCATTAATGTGGAAAGACT

CCGATCACTTCAGTAATAAAGAAT GCACACAGCGCTTCGCCATCTTTTGCTTATTCAGGATGGGAGCTCAGGTGTTTGACACGGACATGGTGATTGTGG

ACCAGACAGTCACAGATATATGTTTCGAAAATGTCACCATCTT CAACGAGGCAGGACCGGACTTCCAGATAAAGATAGAAGTCTACAGCTGCAGCGCAG

AGGAGTCCTCCCTAACCAACACCCCGAGGAAGCTGGCTAAGAAGCTGAAGACGTCCATCAGCAAAGCCACGGGAAGGAAAATCAGCGCAGCGCTCCAGGA

AGAGAGCCCAGAGGCGTGCTTGCTCGCTGGTTCTGTGGC AGGTGCAAAGTACCATTTGCTGGCTCATACCACCCTGACCTTGGAAAATGCTGGAGACTG

CTTTAAGACCCATAACCTGTCTGTTCACGGAGATG AGGAGTGTTCCTTTTGGCTTCCCTTGTATGGCAACGTGTGCTGCCGGCTGGTGGCCCAGCCAGC

TTGCATGGCTGCAGATGCATTTGCAGGATTCCTTAATGAACAG CAAACAGGAAAAGGTCTGGTTGGCTGGAGAAGGCTGTACTGTGCTCTGAGAGGGGG

TAAACTCCGCTGCTTTTATGGTCCGGAAGAAATTGAAGCTAAAGTGGAGCCGGCTCTGGTGGTTCCTATTGACAAG - UNI32305 - GAAACCAGAA

TTCAGGCCGTGGAAAAGGATTCAAAGAAAATGCACTGTTTCTCTGTCCTCAGCACAGCCGCTGGGCGGGCGGTGAGTCACATCTTTGCGGCTGACAGCCT

AGCAGACTTTCAGGAGTGGATGGGCGCCTTCCGGCAACATTTCTTTGATCTCA GCCAATGGAAGCATTGTTGTGAAGAACTTATGAGAATTGAGATTAT

GTCACCACGAAAACCACCTTTGTTCCTGGCAAAGGAGGCGACCTCAGTGTATTATGATATGA - UNI35456 - GCATCGATTCACCCGTGAAACTGG

AAAGTGTAACAGACATAATACAAAAGAAAATCGGAGAGACCAACCGACAGTTCCTCATTGGTCGGGATGACCAATCCGCAGCACCCCCGTGGGCCGCTGT

CTTTGATGGCAATCACGAAATGGTCATAGAGAAGAAAGTGTTGTCCCCAATAGGCGAACCGGCTCCGGATGGAAAAAGAAAAAAGAGGCGAGCCCCACTC

CCTCCTACCGATCAGCCGCCCTTCTGCATAAAAACCCAGGGTAGAGCGAATCAGTCCAAGGACAGCGCAACCCAGGCTGGGGTCTCTGGAGCCTCATCTT

CGCCTTCGGATCCCAGACTGTCGCCGCCTACGCATCATCTCCAGAAACCTGTGGCAGCCCCTCGCAAACTTCTCCCTGCCAGGAAGAACAGTTCAGCGGA

CATTGGGCACACGGACACTAAAACCAGCCTTGATGCGAAGCCAGTGCCAGTTCCAAGGCAGAAATCCATCAGAGACATTCTGGACCCACGATCTTGGCTC

CAAGCACAAGTATAGGAAGCCGGGACTATGTAAATCCAGCTGTAAGGCTCTGGTCAGAGGCATTCTATGGGTAATGTTATGTAATTGTATAGGTAAAGGC

CAGAGCAGTTTCCAGAAGCCATTAATAAGCTGTTAGGTACAGAAAAGCACCTTTAAGTAGAGAATTAGATTTCTCCTTTCCAGAATAGAAATGATCCTCC

CCTCCCCGGAGCAAAAGAGGCAGTTTCTAGACAGTAGCCTACTTTTTGGAAGGGTTAATTTACTCCTAATTTAGTAGCAGGCAGTGAACAGACAGAAGGC

AGAGGAAAGCATTGTTTTTTTGTTTTTTGTTTTTTTTTTTTGAGAGTGAGTTTAGTAATGTAGAATGTGTTCAATACAAGCCGTATTCTCATTGTG
Translation
MEGQLLRGLAAQQ - UNI20577 - DCSIREKIDLEIRMREGIWKLLSLSTKKDQVLHAVKNLMVCSARIQAYTAELQKSKEEIANQTGAR RDSSSE

NKEGESCRGKIALSD DIRIPLMWKDSDHFSNKEC CTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIF FNEAGPDFQIKIEVYSCSAEESS

LTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGSVA AGAKYHLLAHTTLTLENAGDCFKTHNLSVHGDE EECSFWLPLYGNVCCRLVAQPA

CMAADAFAGFLNEQ QTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDK - UNI32305 - ETRIQAVEKDSKKMHCFSVLSTAAGRA

VSHIFAADSLADFQEWMGAFRQHFFDLS SQWKHCCEELMRIEIMSPRKPPLFLAKEATSVYYDMS - UNI35456 - SIDSPVKLESVTDIIQKKIG

ETNRQFLIGRDDQSAAPPWAAVFDGNHEMVIEKKVLSPIGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGRANQSKDSATQAGVSGASSSPSDPRLSPPTH

HLQKPVAAPRKLLPARKNSSADIGHTDTKTSLDAKPVPVPRQKSIRDILDPRSWLQAQV
Transcript ENSMUST00000118160
Sequence
GCTTAAGCCCTGCGGTAGCAGAGGGTCTGTTCAGAGTCTCGGGTCTCCGTGCTGTTTTAAAGACAGAGAGGCTCCTAGTACGCTTGCGCGGCGTCGTGGG

CCGGGTTCCCCTGCAGACCAGACTTGGTACGGCCGAGCGGTTGGTGCAATCTGCAGCTGCAGCCCTGGGGCGCGCTTTTCAAATCGGCCGTGCCTTGCAC

CGAGATGGAGGGGCAGCTGCTGAGGGGTCTCGCCGCGCAGCAG - UNI20577 - GACTGCAGCATCCGAGAGAAAATAGACTTAGAGATCCGCATGC

GAGAAGGAATATGGAAGCTGCTCTCGCTGAGTACGAAAAAAGACCAAGTTTTGCATGCAGTTAAGAACCTCATGGTGTGCAGTGCTCGGATCCAGGCGTA

CACGGCAGAGCTGCAGAAGTCAAAAGAAGAGATTGCAAATCAAACCGGAGCACGGTTAGTGCT GGATTCGAGTTCTGAAAATAAAGAAGGAGAATCCTG

CAGAGGAAAGATCGCCCTGTCAG ATATCCGAATACCATTAATGTGGAAAGACTCCGATCACTTCAGTAATAAAGAAT GCACACAGCGCTTCGCCATCT

TTTGCTTATTCAGGATGGGAGCTCAGGTGTTTGACACGGACATGGTGATTGTGGACCAGACAGTCACAGATATATGTTTCGAAAATGTCACCATCTT CA

ACGAGGCAGGACCGGACTTCCAGATAAAGATAGAAGTCTACAGCTGCAGCGCAGAGGAGTCCTCCCTAACCAACACCCCGAGGAAGCTGGCTAAGAAGCT

GAAGACGTCCATCAGCAAAGCCACGGGAAGGAAAATCAGCGCAGCGCTCCAGGAAGAGAGCCCAGAGGCGTGCTTGCTCGCTGGTTCTGTGGC AGGTGC

AAAGTACCATTTGCTGGCTCATACCACCCTGACCTTGGAAAATGCTGGAGACTGCTTTAAGACCCATAACCTGTCTGTTCACGGAGATG AGGAGTGTTC

CTTTTGGCTTCCCTTGTATGGCAACGTGTGCTGCCGGCTGGTGGCCCAGCCAGCTTGCATGGCTGCAGATGCATTTGCAGGATTCCTTAATGAACAG CA

AACAGGAAAAGGTCTGGTTGGCTGGAGAAGGCTGTACTGTGCTCTGAGAGGGGGTAAACTCCGCTGCTTTTATGGTCCGGAAGAAATTGAAGCTAAAGTG

GAGCCGGCTCTGGTGGTTCCTATTGACAAG - UNI32305 - GAAACCAGAATTCAGGCCGTGGAAAAGGATTCAAAGAAAATGCACTGTTTCTCTGT

CCTCAGCACAGCCGCTGGGCGGGCGGTGAGTCACATCTTTGCGGCTGACAGCCTAGCAGACTTTCAGGAGTGGATGGGCGCCTTCCGGCAACATTTCTTT

GATCTCA GCCAATGGAAGCATTGTTGTGAAGAACTTATGAGAATTGAGATTATGTCACCACGAAAACCACCTTTGTTCCTGGCAAAGGAGGCGACCTCA

GTGTATTATGATATGA - UNI35456 - GCATCGATTCACCCGTGAAACTGGAAAGTGTAACAGACATAATACAAAAGAAAATCGGAGAGACCAACCG

ACAGTTCCTCATTGGTCGGGATGACCAATCCGCAGCACCCCCGTGGGCCGCTGTCTTTGATGGCAATCACGAAATGGTCATAGAGAAGAAAGTGTTGTCC

CCAATAGGCGAACCGGCTCCGGATGGAAAAAGAAAAAAGAGGCGAGCCCCACTCCCTCCTACCGATCAGCCGCCCTTCTGCATAAAAACCCAGGGTAGAG

CGAATCAGTCCAAGGACAGCGCAACCCAGGCTGGGGTCTCTGGAGCCTCATCTTCGCCTTCGGATCCCAGACTGTCGCCGCCTACGCATCATCTCCAGAA

ACCTGTGGCAGCCCCTCGCAAACTTCTCCCTGCCAGGAAGAACAGTTCAGCGGACATTGGGCACACGGACACTAAAACCAGCCTTGATGCGAAGCCAGTG

CCAGTTCCAAGGCAGAAATCCATCAGAGACATTCTGGACCCACGATCTTGGCTCCAAGCACAAGTATAGGAAGCCGGGACTATGTAAATCCAGCTGTAAG

GCTCTGGTCAGAGGCATTCTATGGGTAATGTTATGTAATTGTATAGGTAAAGGCCAGAGCAGTTTCCAGAAGCCATTAATAAGCTGTTAGGTACAGAAAA

GCACCTTTAAGTAGAGAATTAGATTTCTCCTTTCCAGAATAGAAATGATCCTCCCCTCCCCGGAGCAAAAGAGGCAGTTTCTAGACAGTAGCCTACTTTT

TGGAAGGGTTAATTTACTCCTAATTTAGTAGCAGGCAGTGAACAGACAGAAGGCAGAGGAAAGCATTGTTTTTTTGTTTTTTGTTTTTTTTTTTTGAGAG

TGAGTTTAGTAATGTAGAATGTGTTCAATACAAGCCGTATTCTCATTGTGAGAATTGTAATACTTAATAGAATATTTCAGAGTTTTTGTTTAAACCACAA

ATTACAGAATCCACCCAAGAAAATGTTTCCCCTCCGCTTCCTGGAATTGGCATCTAAGGGTCCTCTGGCTTCTCCTCTGTTGTTTAACTCAATGGTCTCT

AGGGTTGATCTTTTCAATTCCTGGTATAAAGTCTTCGAATATTAAAAACTCTTTGTCTTTAAAGGGAATTTGTAATCTGCTATTCAAATTCATTTCCTTG

ATGAGCCCTGAAATCCTGTGGACTTGGCTGCTCATCAGCAAGGAGCATGCTTCTTGGTGAGTGAAGTGGCAATGAGATGTCCCCCCATTGCTGGGCTTCC

TGTATGATGTTAATCTCCATCATGGCCTCTGGAGTTCAGGGAGACAAGTAGCCAATTAATGCCTTTAAATTTTTACTTAATACTTATTTTAAAAGCAGAT

GGCAGATTCAAAATTTATCAGGAAGGTTTGACCGCAGTAATTTTCAGAATTAATCCTTTTTCAATTTTTTAATTAGATTTTCTTTTTTTTGAGTGAGGGC

TGATGTCGGTTATTGATATTGCCCGTTAAAAGTCATATTCATTCAGTAATCACATTGGCGTCATTTCCATAGAAGGTAATTTCCATGGCAACTAATCACA

GTGACCCAAACAGGATTATAAATTGAATAGGGGGGATAACTAGCAAGAGAATGAATATCTTAAGTGGACAAAAAGAAAAACCCACTTTTTATAATAACCC

CTTTTGTAAACAAGAACAGCGGAACGGTTTTAAAATGTCATCATAATTTCCAAGCAAAACTTCCCAGAGGGTATTAAAACAGTCCTGAACAGACCAGGAC

CTCCCAAGCCCTAACGGGCACCACAAACCATCACACTGAAGGAAGGAGGCTCCAGGCTGCTGAGCTCTGTCCATCTGGATGGGAACTACATCTGTGTAAA

GTGGCCAACAAAGGTATTGATCGGACCAACCCATTCATCGCTTTTAGGGGATAGTTTGTCTGTTTTGTCTTGTTTTTGTTTCTCATTTCTGCACAGTGCT

CCTCTAACTAACAGGTAATATGTACACTATTGCTTGCCCAGGACCCCCAGTAAAAAAGGGGAACCCGAGAGCAGCGACAAAGGGCCCTCTGTGAAGGCAG

AAGGCAGAAGCTGTGTGGAGACTCCTACAGCCATGGAAACTTGAAGAATAGGTGGCCGTGGTTTTGTTTTTGTTTTAATCTAACAGGGTCTCAAAAGTTT

TGGTGGTAATTGCCATTTCTTTCTTTTTAATACTTACTTTATGTATTTAAGTACACCATAGCTGTCTTCAGACACACCAGAAGAGGGCATCAGATCCCAT

TACAGATGGTCATGAGCCACCATGTGGTTGTTGGGAACTGAACTCAGCACCTCTGGAAGAGCAAGTCCTGAGCCATCTCTCCAGCCCCAGTAAAGTTGTA

TTTTTTGCTTGAAAATGCCTCTGTTAGCCCTCACCGATATCTTCAACAATGCCCATGAACTTTTGATGCAACCTCTTTTTTTTTTTTTTTTTTTTTAATT

AAAAGATGCTGCTGGCAAAA
Translation
MEGQLLRGLAAQQ - UNI20577 - DCSIREKIDLEIRMREGIWKLLSLSTKKDQVLHAVKNLMVCSARIQAYTAELQKSKEEIANQTGARLVL LDS

SSENKEGESCRGKIALSD DIRIPLMWKDSDHFSNKEC CTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIF FNEAGPDFQIKIEVYSCSAE

ESSLTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGSVA AGAKYHLLAHTTLTLENAGDCFKTHNLSVHGDE EECSFWLPLYGNVCCRLVA

QPACMAADAFAGFLNEQ QTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDK - UNI32305 - ETRIQAVEKDSKKMHCFSVLSTAA

GRAVSHIFAADSLADFQEWMGAFRQHFFDLS SQWKHCCEELMRIEIMSPRKPPLFLAKEATSVYYDMS - UNI35456 - SIDSPVKLESVTDIIQK

KIGETNRQFLIGRDDQSAAPPWAAVFDGNHEMVIEKKVLSPIGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGRANQSKDSATQAGVSGASSSPSDPRLSP

PTHHLQKPVAAPRKLLPARKNSSADIGHTDTKTSLDAKPVPVPRQKSIRDILDPRSWLQAQV
Transcript ENSMUST00000068994
Sequence
GTCTCGGGTCTCCGTGCTGTTTTAAAGACAGAGAGGCTCCTAGTACGCTTGCGCGGCGTCGTGGGCCGGGTTCCCCTGCAGACCAGACTTGGTACGGCCG

AGCGGTTGGTGCAATCTGCAGCTGCAGCCCTGGGGCGCGCTTTTCAAATCGGCCGTGCCTTGCACCGAGATGGAGGGGCAGCTGCTGAGGGGTCTCGCCG

CGCAGCAG - UNI20577 - GACTGCAGCATCCGAGAGAAAATAGACTTAGAGATCCGCATGCGAGAAGGAATATGGAAGCTGCTCTCGCTGAGTACG

AAAAAAGACCAAGTTTTGCATGCAGTTAAGAACCTCATGGTGTGCAGTGCTCGGATCCAGGCGTACACGGCAGAGCTGCAGAAGTCAAAAGAAGAGATTG

CAAATCAAACCGGAGCACGGTTAGTGCT GGATTCGAGTTCTGAAAATAAAGAAGGAGAATCCTGCAGAGGAAAGATCGCCCTGTCAG ATATCCGAATA

CCATTAATGTGGAAAGACTCCGATCACTTCAGTAATAAAGAAT GCACACAGCGCTTCGCCATCTTTTGCTTATTCAGGATGGGAGCTCAGGTGTTTGAC

ACGGACATGGTGATTGTGGACCAGACAGTCACAGATATATGTTTCGAAAATGTCACCATCTT CAACGAGGCAGGACCGGACTTCCAGATAAAGATAGAA

GTCTACAGCTGCAGCGCAGAGGAGTCCTCCCTAACCAACACCCCGAGGAAGCTGGCTAAGAAGCTGAAGACGTCCATCAGCAAAGCCACGGGAAGGAAAA

TCAGCGCAGCGCTCCAGGAAGAGAGCCCAGAGGCGTGCTTGCTCGCTGGTTCTGTGGC AGGTGCAAAGTACCATTTGCTGGCTCATACCACCCTGACCT

TGGAAAATGCTGGAGACTGCTTTAAGACCCATAACCTGTCTGTTCACGGAGATG AGGAGTGTTCCTTTTGGCTTCCCTTGTATGGCAACGTGTGCTGCC

GGCTGGTGGCCCAGCCAGCTTGCATGGCTGCAGATGCATTTGCAGGATTCCTTAATGAACAG CAAACAGGAAAAGGTCTGGTTGGCTGGAGAAGGCTGT

ACTGTGCTCTGAGAGGGGGTAAACTCCGCTGCTTTTATGGTCCGGAAGAAATTGAAGCTAAAGTGGAGCCGGCTCTGGTGGTTCCTATTGACAAG - UN

I32305 - GAAACCAGAATTCAGGCCGTGGAAAAGGATTCAAAGAAAATGCACTGTTTCTCTGTCCTCAGCACAGCCGCTGGGCGGGCGGTGAGTCACA

TCTTTGCGGCTGACAGCCTAGCAGACTTTCAGGAGTGGATGGGCGCCTTCCGGCAACATTTCTTTGATCTCA GCCAATGGAAGCATTGTTGTGAAGAAC

TTATGAGAATTGAGATTATGTCACCACGAAAACCACCTTTGTTCCTGGCAAAGGAGGCGACCTCAGTGTATTATGATATGA - UNI35456 - GCATC

GATTCACCCGTGAAACTGGAAAGTGTAACAGACATAATACAAAAGAAAATCGGAGAGACCAACCGACAGTTCCTCATTGGTCGGGATGACCAATCCGCAG

CACCCCCGTGGGCCGCTGTCTTTGATGGCAATCACGAAATGGTCATAGAGAAGAAAGTGTTGTCCCCAATAGGCGAACCGGCTCCGGATGGAAAAAGAAA

AAAGAGGCGAGCCCCACTCCCTCCTACCGATCAGCCGCCCTTCTGCATAAAAACCCAGGGTAGAGCGAATCAGTCCAAGGACAGCGCAACCCAGGCTGGG

GTCTCTGGAGCCTCATCTTCGCCTTCGGATCCCAGACTGTCGCCGCCTACGCATCATCTCCAGAAACCTGTGGCAGCCCCTCGCAAACTTCTCCCTGCCA

GGAAGAACAGTTCAGCGGACATTGGGCACACGGACACTAAAACCAGCCTTGATGCGAAGCCAGTGCCAGTTCCAAGGCAGAAATCCATCAGAGACATTCT

GGACCCACGATCTTGGCTCCAAGCACAAGTATAGGAAGCCGGGACTATGTAAATCCAGCTGTAAGGCTCTG - UNI35456 - GGAATTTGTAATCTG

CTATTCAAATTCATTTCCTTGATGAGCCCTGAAATCCTGTGGACTTGGCTGCTCATCAGCAAGGAGCATGCTTCTTG - UNI35456 - GGAAAAGGA

GAAGTTTGGAAAGCCTGCTCTGTCACCTGGCATGGAAGGCTTCCGGGTGTTTACAATTCTTCCAGTGAATGGCAGTGATATTGCAAAATGTGATTCTTTG

TATTGTGTGACGAAATGTTCCAATATTTGCAAAACCTGGGTCAGCCAATCACATACTCCAGATTGTGGGTACATGAAGTTACAAAATCCTACATGATGCA

AAAGTTCAAGGGGGAGTCTTGGATACTATTGTAACAGTACAAAGTGTTCATGAACATGACTGTACGGCAACAACTATGCCTTGTCAGCTTTTGAAATGTG

ACCAGAAGCAATGGTCATGTCACAAGACAATGCTGTTAAAGAACCTTCTCCCTTATTAAGCTGG GGCTGAAGGAAGGAAGATTGCTATCGCCCCATGTG

TGTCAGA
Translation
MEGQLLRGLAAQQ - UNI20577 - DCSIREKIDLEIRMREGIWKLLSLSTKKDQVLHAVKNLMVCSARIQAYTAELQKSKEEIANQTGARLVL LDS

SSENKEGESCRGKIALSD DIRIPLMWKDSDHFSNKEC CTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIF FNEAGPDFQIKIEVYSCSAE

ESSLTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGSVA AGAKYHLLAHTTLTLENAGDCFKTHNLSVHGDE EECSFWLPLYGNVCCRLVA

QPACMAADAFAGFLNEQ QTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDK - UNI32305 - ETRIQAVEKDSKKMHCFSVLSTAA

GRAVSHIFAADSLADFQEWMGAFRQHFFDLS SQWKHCCEELMRIEIMSPRKPPLFLAKEATSVYYDMS - UNI35456 - SIDSPVKLESVTDIIQK

KIGETNRQFLIGRDDQSAAPPWAAVFDGNHEMVIEKKVLSPIGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGRANQSKDSATQAGVSGASSSPSDPRLSP

PTHHLQKPVAAPRKLLPARKNSSADIGHTDTKTSLDAKPVPVPRQKSIRDILDPRSWLQAQV - UNI35456 -  - UNI35456 -  
Transcript ENSMUST00000105437
Sequence
GTTCAGAGTCTCGGGTCTCCGTGCTGTTTTAAAGACAGAGAGGCTCCTAGTACGCTTGCGCGGCGTCGTGGGCCGGGTTCCCCTGCAGACCAGACTTGGT

ACGGCCGAGCGGTTGGTGCAATCTGCAGCTGCAGCCCTGGGGCGCGCTTTTCAAATCGGCCGTGCCTTGCACCGAGATGGAGGGGCAGCTGCTGAGGGGT

CTCGCCGCGCAGCAG - UNI20577 - GACTGCAGCATCCGAGAGAAAATAGACTTAGAGATCCGCATGCGAGAAGGAATATGGAAGCTGCTCTCGCT

GAGTACGAAAAAAGACCAAGTTTTGCATGCAGTTAAGAACCTCATGGTGTGCAGTGCTCGGATCCAGGCGTACACGGCAGAGCTGCAGAAGTCAAAAGAA

GAGATTGCAAATCAAACCGGAGCACG GGATTCGAGTTCTGAAAATAAAGAAGGAGAATCCTGCAGAGGAAAGATCGCCCTGTCAG ATATCCGAATACC

ATTAATGTGGAAAGACTCCGATCACTTCAGTAATAAAGAAT GCACACAGCGCTTCGCCATCTTTTGCTTATTCAGGATGGGAGCTCAGGTGTTTGACAC

GGACATGGTGATTGTGGACCAGACAGTCACAGATATATGTTTCGAAAATGTCACCATCTT CAACGAGGCAGGACCGGACTTCCAGATAAAGATAGAAGT

CTACAGCTGCAGCGCAGAGGAGTCCTCCCTAACCAACACCCCGAGGAAGCTGGCTAAGAAGCTGAAGACGTCCATCAGCAAAGCCACGGGAAGGAAAATC

AGCGCAGCGCTCCAGGAAGAGAGCCCAGAGGCGTGCTTGCTCGCTGGTTCT GCAGTTCTGG GTGCAAAGTACCATTTGCTGGCTCATACCACCCTGAC

CTTGGAAAATGCTGGAGACTGCTTTAAGACCCATAACCTGTCTGTTCACGGAGATG AGGAGTGTTCCTTTTGGCTTCCCTTGTATGGCAACGTGTGCTG

CCGGCTGGTGGCCCAGCCAGCTTGCATGGCTGCAGATGCATTTGCAGGATTCCTTAATGAACAG CAAACAGGAAAAGGTCTGGTTGGCTGGAGAAGGCT

GTACTGTGCTCTGAGAGGGGGTAAACTCCGCTGCTTTTATGGTCCGGAAGAAATTGAAGCTAAAGTGGAGCCGGCTCTGGTGGTTCCTATTGACAAG - 

UNI32305 - GAAACCAGAATTCAGGCCGTGGAAAAGGATTCAAAGAAAATGCACTGTTTCTCTGTCCTCAGCACAGCCGCTGGGCGGGCGGTGAGTCA

CATCTTTGCGGCTGACAGCCTAGCAGACTTTCAGGAGTGGATGGGCGCCTTCCGGCAACATTTCTTTGATCTCA GCCAATGGAAGCATTGTTGTGAAGA

ACTTATGAGAATTGAGATTATGTCACCACGAAAACCACCTTTGTTCCTGGCAAAGGAGGCGACCTCAGTGTATTATGATATGA - UNI35456 - GCA

TCGATTCACCCGTGAAACTGGAAAGTGTAACAGACATAATACAAAAGAAAATCGGAGAGACCAACCGACAGTTCCTCATTGGTCGGGATGACCAATCCGC

AGCACCCCCGTGGGCCGCTGTCTTTGATGGCAATCACGAAATGGTCATAGAGAAGAAAGTGTTGTCCCCAATAGGCGAACCGGCTCCGGATGGAAAAAGA

AAAAAGAGGCGAGCCCCACTCCCTCCTACCGATCAGCCGCCCTTCTGCATAAAAACCCAGGGTAGAGCGAATCAGTCCAAGGACAGCGCAACCCAGGCTG

GGGTCTCTGGAGCCTCATCTTCGCCTTCGGATCCCAGACTGTCGCCGCCTACGCATCATCTCCAGAAACCTGTGGCAGCCCCTCGCAAACTTCTCCCTGC

CAGGAAGAACAGTTCAGCGGACATTGGGCACACGGACACTAAAACCAGCCTTGATGCGAAGCCAGTGCCAGTTCCAAGGCAGAAATCCATCAGAGACATT

CTGGACCCACGATCTTGGCTCCAAGCACAAGTATAGGAAGCCGGGACTATGTAAATCCAGCTGTAAGGCTCTGGTCAGAGGCATTCTATGGGTAATGTTA

TGTAATTGTATAGGTAAAGGCCAGAGCAGTTTCCAGAAGCCATTAATAAGCTGTTAGGTACAGAAAAGCACCTTTAAGTAGAGAATTAGATTTCTCCTTT

CCAGAATAGAAATGATCCTCCCCTCCCCGGAGCAAAAGAGGCAGTTTCTAGACAGTAGCCTACTTTTTGGAAGGGTTAATTTACTCCTAATTTAGTAGCA

GGCAGTGAACAGACAGAAGGCAGAGGAAAGCATTGTTTTTTTGTTTTTTGTTTTTTTTTTTTGAGAGTGAGTTTAGTAATGTAGAATGTGTTCAATACAA

GCCGTATTCTCATTGTGAGAATTGTAATACTTAATAGAATATTTCAGAGTTTTTGTTTAAACCACAAATTACAGAATCCACCCAAGAAAATGTTTCCCCT

CCGCTTCCTGGAATTGGCATCTAAGGGTCCTCTGGCTTCTCCTCTGTTGTTTAACTCAATGGTCTCTAGGGTTGATCTTTTCAATTCCTGGTATAAAGTC

TTCGAATATTAAAAACTCTTTGTCTTTAAAGGGAATTTGTAATCTGCTATTCAAATTCATTTCCTTGATGAGCCCTGAAATCCTGTGGACTTGGCTGCTC

ATCAGCAAGGAGCATGCTTCTTGGTGAGTGAAGTGGCAATGAGATGTCCCCCCATTGCTGGGCTTCCTGTATGATGTTAATCTCCATCATGGCCTCTGGA

GTTCAGGGAGACAAGTAGCCAATTAATGCCTTTAAATTTTTACTTAATACTTATTTTAAAAGCAGATGGCAGATTCAAAATTTATCAGGAAGGTTTGACC

GCAGTAATTTTCAGAATTAATCCTTTTTCAATTTTTTAATTAGATTTTCTTTTTTTTGAGTGAGGGCTGATGTCGGTTATTGATATTGCCCGTTAAAAGT

CATATTCATTCAGTAATCACATTGGCGTCATTTCCATAGAAGGTAATTTCCATGGCAACTAATCACAGTGACCCAAACAGGATTATAAATTGAATAGGGG

GGATAACTAGCAAGAGAATGAATATCTTAAGTGGACAAAAAGAAAAACCCACTTTTTATAATAACCCCTTTTGTAAACAAGAACAGCGGAACGGTTTTAA

AATGTCATCATAATTTCCAAGCAAAACTTCCCAGAGGGTATTAAAACAGTCCTGAACAGACCAGGACCTCCCAAGCCCTAACGGGCACCACAAACCATCA

CACTGAAGGAAGGAGGCTCCAGGCTGCTGAGCTCTGTCCATCTGGATGGGAACTACATCTGTGTAAAGTGGCCAACAAAGGTATTGATCGGACCAACCCA

TTCATCGCTTTTAGGGGATAGTTTGTCTGTTTTGTCTTGTTTTTGTTTCTCATTTCTGCACAGTGCTCCTCTAACTAACAGGTAATATGTACACTATTGC

TTGCCCAGGACCCCCAGTAAAAAAGGGGAACCCGAGAGCAGCGACAAAGGGCCCTCTGTGAAGGCAGAAGGCAGAAGCTGTGTGGAGACTCCTACAGCCA

TGGAAACTTGAAGAATAGGTGGCCGTGGTTTTGTTTTTGTTTTAATCTAACAGGGTCTCAAAAGTTTTGGTGGTAATTGCCATTTCTTTCTTTTTAATAC

TTACTTTATGTATTTAAGTACACCATAGCTGTCTTCAGACACACCAGAAGAGGGCATCAGATCCCATTACAGATGGTCATGAGCCACCATGTGGTTGTTG

GGAACTGAACTCAGCACCTCTGGAAGAGCAAGTCCTGAGCCATCTCTCCAGCCCCAGTAAAGTTGTATTTTTTGCTTGAAAATGCCTCTGTTAGCCCTCA

CCGATATCTTCAACAATGCCCATGAACTTTTGATGCAACCTCTTTTTTTTTTTTTTTTTTTTTAATTAAAAGATGCTGCTGGC
Translation
MEGQLLRGLAAQQ - UNI20577 - DCSIREKIDLEIRMREGIWKLLSLSTKKDQVLHAVKNLMVCSARIQAYTAELQKSKEEIANQTGAR RDSSSE

NKEGESCRGKIALSD DIRIPLMWKDSDHFSNKEC CTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIF FNEAGPDFQIKIEVYSCSAEESS

LTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGS AVLG GAKYHLLAHTTLTLENAGDCFKTHNLSVHGDE EECSFWLPLYGNVCCRLVAQ

PACMAADAFAGFLNEQ QTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDK - UNI32305 - ETRIQAVEKDSKKMHCFSVLSTAAG

RAVSHIFAADSLADFQEWMGAFRQHFFDLS SQWKHCCEELMRIEIMSPRKPPLFLAKEATSVYYDMS - UNI35456 - SIDSPVKLESVTDIIQKK

IGETNRQFLIGRDDQSAAPPWAAVFDGNHEMVIEKKVLSPIGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGRANQSKDSATQAGVSGASSSPSDPRLSPP

THHLQKPVAAPRKLLPARKNSSADIGHTDTKTSLDAKPVPVPRQKSIRDILDPRSWLQAQV

For any suggestions or comments, please send an email to unitrap@crg.es