Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037851 (Iars)
Chromosomal location
Chr 13: 49777512 - 49829628 (+)
Description
isoleucine-tRNA synthetase Gene [Source:MGI Symbol;Acc:MGI:2145219]
RefSeq_dna
NM_172015 
RefSeq_peptide
NP_742012.1 
UniGene
Mm.21118 
MGI
MGI:2145219 
Uniprot/SWISSPROT
Q8BU30 
Uniprot/SPTREMBL
Q3UWS7 Q6NXK4 Q99LT1 
Human Ortholog
ENSG00000196305 (IARS)
Omim not available
UniTrap UNI10762
Vector Insertion
Chr 13: 49777573 - 49782754
Public Clones (sanger) P122C08 (ggtc) P105E07 (ggtc) H011B08 (ggtc) P147H10 (ggtc)
PST17504-NR (escells) PST7247-NR (escells) IST15007C7 (tigm) IST14646A6 (tigm)
IST14392D12 (tigm)
Private Clones OST184002 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16705
Vector Insertion
Chr 13: 49782881 - 49783525
Public Clones not available
Private Clones OST455737 (lexicon) OST408577 (lexicon) OST388767 (lexicon) OST326512 (lexicon)
OST250743 (lexicon) OST222801 (lexicon) OST181857 (lexicon) OST144711 (lexicon)
OST59506 (lexicon) OST42380 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23230
Vector Insertion
Chr 13: 49783683 - 49783892
Public Clones not available
Private Clones OST269970 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12402
Vector Insertion
Chr 13: 49786981 - 49788392
Public Clones W052D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5493
Vector Insertion
Chr 13: 49788541 - 49797212
Public Clones YTA056 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8955
Vector Insertion
Chr 13: 49800294 - 49801155
Public Clones RRE241 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36383
Vector Insertion
Chr 13: 49818446 - 49819986
Public Clones IST10091G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9769
Vector Insertion
Chr 13: 49825510 - 49826786
Public Clones XG885 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12380
Vector Insertion
Chr 13: 49827862 - 49829027
Public Clones W070E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047363
Sequence
CACCTCCAGACGCGGAACGTGGTCGCAGGCTGCAACCTGAGCGAGCTCTCCGGGTTCCCAG - UNI10762 - CAACAGAATGGTTCAACAAGTTCCA

GAAAACATCAGTTTTCCTGCTGAAGAAGAAAAAATCTTGGAGTTCTGGTCCAAACATAACTGTTTCCAGGAATGCCTCAAACAGTCAAAACTCAGGCCAA

A - UNI16705 - GTTTACCTTCTATGATGGGCCTCCCTTTGCTACTGGACTGCCTCACTATGGACACATACTTGCTGGGACAATCAAAGATATCGTT

ACGAGATACGCTCACCAGAGCGGGTTTCACGTTGACAGAAGATTCGGGTGGGACTGTCACGGCTTACCTGTG - UNI23230 - GAGTACGAAATCGA

TAAGACACTGGGCATCAAAGGCCCGGAGGATGTGGCCAAAATGGGGATTGCAGAGTACAACAAGCAGTGCCGAGCAATCGTGATGAGATACTCCGCTGAG

TGGAAG TCTACTGTTACCAGACTCGGCCGATGGATCGACTTTGACAATGACTACAAAACACTATACCCACAGTTCATGGAATCAGTCTG GTGGGTCTT

CAAGCAGCTGTATGACAAAGGCCTCGTGTACAGAGGCGTGAAGGTCATGCCCTTCTCCACCGCGTGTGGCACTCCACTCTCCAACTTCGAATCTAACCAG

AATTACAAG - UNI12402 - GATGTTCAGGATCCCTCAGTATTTGTAACATTCCCTTTGGAGGAAGATGAAAATACATCCTTAGTTGCTTGGACAAC

CACTCCTTGGACTCTACCCAGTAACCTTGCACTATGCGTCAATCCAGAAATACAGTATGTGAAGATCAAAG - UNI5493 - ATGTGGCCAGGGGAAA

ATTATTCATCTTAACGGAAGCCAGATTATCGGCCCTCTATAAGCAAGAGAGCGACTATGAGATACTTGAAAG GTTTCCTGGTGCCTCTCTCAAAGGCAA

GAAATACAAGCCGTTGTTTGACTACTTTATTAAG TGTAAGGAGAACGGTGCCTTCACCGTGCTTGTCGACCACTATGTGAAGGATGAAGAAGGCACAGG

CGTTGTGCACCAGGCTCCTTACTTTGGTGCT GATGATCATCGTGTCTGTATGGACTTCAACATTATTCAGAAAGACTCAGTCCCTGTTTGTCCTGTGGA

TGCTTCAGGCTGCTTCACAGAGGAAGTGACACATTTTGTGGGGCAGTATGTGAAG GATGCTGACAAAAATATCATTAGGATGTTGAAGGAGCAGGGCCG

GCTGCTGGCGGCGGGCACGTTCACTCACAGCTACCCTTTCTGCTGGAG - UNI8955 - GTCAGACACGCCCCTCATTTACAAGTCTGTGCCCAGCTG

GTTTGTGCGGGTGGAGCCCATGGTGGACCAGCTACTGAAGAACAACGACCTGTGCTACTG GGTCCCAGAGTTTGTACGAGAAAAACGGTTTGGAAATTG

GCTGAAGGAGGCCCGTGACTGGGCAATTTCCAGAAACAGATACTGGGGCACCCCCATCCCACTGTGGGTCAGCGAAGACTTGGAGGAG GTAGTGTGCAT

TGGATCAGTGGCAGAGCTTGAAGAACTGTCGGGAACAAAAATCTCAGATCTCCACAGAGAGAG CATCGACCACCTGACCATCCCATCCCGCTGCGGGAA

AGCACCATTGCGGCGCGTCTCTGAGGTGTTTGACTGCTGGTTCGAGAGTGGAAGTATGCCCTATGCCCAGGTCCATTATCCGTTCGAGAGCAAGCGCGAG

TTTGAGGATGCCTTTCCTGCAGACTTCATTGCTGAAGGCATCGATCAAACCAGAGGATG GTTTTACACCCTGCTGGTGCTAGCCACAGCGCTCTTTGGA

CAGCCACCTTTCAAGAATGTGATTGTGAATGGCCTCATCTTGGCAAG TGATGGCCAAAAAATGAGCAAGCGGAAAAAGAACTACCCAGATCCAGTTTCC

ATCATCGATAAGTATGGTGCGGACGCCCTCAG GTTATATCTGATCAATTCCCCTGTGGTAAGAGCAGAAAACCTGCGCTTCAAGGAGGAAGGTGTGCGG

GATGTCCTCAAAGATGTGCTGCTCCCGTGGTACAACGCTTACCGCTTCTTCATCCAGAACGTCTTTAGGCTCCACAAG GAAGAAGAAGTGAAGTTCCTA

TACAACGAGCATACAGTCAGAGAAAGCCCTAACATCACCGACCGCTGGGTTCTGTCCTTCATGCAGTCGCTCCTTGGCTTCTTTGAGACCGAAATGGCAG

 CTTACAGGCTGTACACTGTGGTACCTCGCCTGGTCAAGTTTGTAGATATTCTAACCAACTGGTATGTCCGAATGAACAGGAGGAGGTTAAAG GGTGAG

AGTGGGGTGGAAGACTGTGTCATGGCTCTGGAGACACTGTTCAGTGTCCTGCTTTCTCTGTGCAGACTGATG GCCCCTTACACGCCCTTTCTGACTGAG

CTGATGTACCAGAATCTAAAGCTGCTGATTGATCCTGCTTCTCTCCGGGACAAGGACACACTCAGCATCCACTACCTCATGCTGCCTCGAGTTCG AGAG

GAGCTGATTGACAAGAAAACTGAGAACGCCGTGTCTAGGATGCAGTCTGTGATCGAGCTTGGAAGAGTGATACGAGACCGAAAAACTATTCCAATAAAG 

TATCCTCTGAAGGAAATTGTGGTCATCCACCAAGACCCAGAAGCTCTAGAGGATATCAGGTCCTTGGAGAAGTATATCATTGAG - UNI36383 - GA

ATTAAATGTTCGAAAAGTCACGCTGTCTACTGATAAAAACAAGTACGGTATCCGACTAAGGGCTGAACCAGATCACATGGTCCTTGGGAAGCGCCTGAAG

GGGGCCTTCAAAGCGGTGATGATGGCCATAAAGCGGCTGAGCAATGAGGAGCTGGAGCGGTTTCAGAAGAGCG GGAGCATTGTTGTGGAAGGCCACGAA

CTGCATGAGGAAGACATTCGCCTCATGTACACCTTTGACCAGGCCACGGGAGGGACCGCGCAGTTTGAAGCACACTCTGATGCTCAG GCTCTAGTTCTC

TTAGATGTCACACCTGACCAGTCAATGGTGGATGAGGGCATGGCTCGGGAAGTCATCAATCGCATCCAGAAGCTTCGAAAGAAG TGCAATCTGGTTCCA

ACGGATGAAATAACAGTTTACTATAATGCAAAATCTGAAGGAAGATACTTGAATAATGTCATTGAAAGCCACACTGACTTCATATTTGCCACAATCAAAG

CTCCCTTGAAGCCATATCCAGTTCCAACATCAGATAATATCCTTATTCAAGAGCAAACACAG TTAAAGGGGTCCGAGCTGGAAATCACGCTCACCAAAG

GATCGTGTGTGCCTGGCCCTGCTTGTGCTTATGTGAACCTTAACATTTGTGCAAATGGCACCGAGCAAG GTGGAGTGTTGCTCCTGGAGAATCCGAAAG

GTGATAATCAGCTGAACCTGGTGAAACTGAAGACTGTTGTTACCAGCGTATTTGGTGTTAAAAATGCAAAGCTGTCAGTCTTCCACGGTGAAACAG - U

NI9769 - AAATACAGAACCAAACTGACTTGCTGAGCCTCAGTGGGAGGACGCTGTGTGTGACTGCAGGGGCATCCCCGTCTCCCATCAGCAGCCCCAG

CACCCTGCTGTGTCAGTACCTCAACCTGCAGCTCCTGAACGCAGAGCCACAAG AGTGTTTAACAGGAACTGTGGGCACCCTCCTGCTTGAAAACCCACT

CGGACAGAACGGCCTCACCCACCAAGGGCTTGTGCATGAAGCAGCCAAGGTGTTCGGACTGAGGAGCAGGAGGCTAAGGCTGTTCCTGAATGAGACTCAA

ACACAAG - UNI12380 - AAATTACAGAAGATATCCCAATGAAGACTTTGAATATGAAGACTGTATATGTTTCTGTCTTGCCAACAACTGCAGATGG

CTAACAGCTATCAGTATGCCTTCAGTCAGTCTTCCTTGAATCTACCCATCTCCTTATACACACACTCACACACTCACACTCTCTATGTCTCTCTCTCTCT

CTCTCTCTCTCTGTCTCTCTCTCACACACACATACACACACACACATGGGTTCAGTGAAGTTATCTCCTTGGGCACTTGTCAAATATGCTGCTTTTAACC

GGCGATTCTAATGGGATTGACTGACTGGAGACCTCACATCATGTTCACATTTAACCTTAAACACCTATGCAGTCATGTTGGGGGAGTGTCCCAATGTTAC

CTCAACACCACGAAGCTTATTTCTATACTGGAGTTCTTCAGTATAGAAAGTGGAAGTGGTTTAAATGGCATAGTACATATACATATATATATGGCCTTGT

AAAACAGATTTGAGACCTTGTGAAGAAATGGATATGTTATATATTTCTGCTACCTGGATTTTCCTGGGTAATTTGATGGAATATTTTACGTTTGATTAAA

TCAAAACAGTAAACACTCTCTT
Translation
 - UNI10762 - MVQQVPENISFPAEEEKILEFWSKHNCFQECLKQSKLRPK - UNI16705 - KFTFYDGPPFATGLPHYGHILAGTIKDIVTRY

AHQSGFHVDRRFGWDCHGLPV - UNI23230 - EYEIDKTLGIKGPEDVAKMGIAEYNKQCRAIVMRYSAEWK STVTRLGRWIDFDNDYKTLYPQFM

ESVW WWVFKQLYDKGLVYRGVKVMPFSTACGTPLSNFESNQNYK - UNI12402 - DVQDPSVFVTFPLEEDENTSLVAWTTTPWTLPSNLALCVNP

EIQYVKIKD - UNI5493 - DVARGKLFILTEARLSALYKQESDYEILER RFPGASLKGKKYKPLFDYFIK CKENGAFTVLVDHYVKDEEGTGVVH

QAPYFGA DDHRVCMDFNIIQKDSVPVCPVDASGCFTEEVTHFVGQYVK DADKNIIRMLKEQGRLLAAGTFTHSYPFCWR - UNI8955 - RSDTPL

IYKSVPSWFVRVEPMVDQLLKNNDLCYW WVPEFVREKRFGNWLKEARDWAISRNRYWGTPIPLWVSEDLEE VVCIGSVAELEELSGTKISDLHRES S

IDHLTIPSRCGKAPLRRVSEVFDCWFESGSMPYAQVHYPFESKREFEDAFPADFIAEGIDQTRGW WFYTLLVLATALFGQPPFKNVIVNGLILAS SDG

QKMSKRKKNYPDPVSIIDKYGADALR RLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAYRFFIQNVFRLHK EEEVKFLYNEHTVRESPNITDRW

VLSFMQSLLGFFETEMAA AYRLYTVVPRLVKFVDILTNWYVRMNRRRLK GESGVEDCVMALETLFSVLLSLCRLM APYTPFLTELMYQNLKLLIDPA

SLRDKDTLSIHYLMLPRVR REELIDKKTENAVSRMQSVIELGRVIRDRKTIPIK YPLKEIVVIHQDPEALEDIRSLEKYIIE - UNI36383 - EL

NVRKVTLSTDKNKYGIRLRAEPDHMVLGKRLKGAFKAVMMAIKRLSNEELERFQKSG GSIVVEGHELHEEDIRLMYTFDQATGGTAQFEAHSDAQ ALV

LLDVTPDQSMVDEGMAREVINRIQKLRKK CNLVPTDEITVYYNAKSEGRYLNNVIESHTDFIFATIKAPLKPYPVPTSDNILIQEQTQ LKGSELEITL

TKGSCVPGPACAYVNLNICANGTEQG GGVLLLENPKGDNQLNLVKLKTVVTSVFGVKNAKLSVFHGETE - UNI9769 - EIQNQTDLLSLSGRTLC

VTAGASPSPISSPSTLLCQYLNLQLLNAEPQE ECLTGTVGTLLLENPLGQNGLTHQGLVHEAAKVFGLRSRRLRLFLNETQTQE - UNI12380 - E

ITEDIPMKTLNMKTVYVSVLPTTADG

For any suggestions or comments, please send an email to unitrap@crg.es