Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037857 (Nufip2)
Chromosomal location
Chr 11: 77499641 - 77555294 (+)
Description
nuclear fragile X mental retardation protein interacting protein 2 Gene [Source:MGI (curated);Acc:Nufip2-001]
RefSeq_dna
NM_001024205 
RefSeq_peptide
NP_001019376.1 
UniGene
Mm.428996 Mm.471343 
MGI
MGI:1915814 
Uniprot/SWISSPROT
Q5F2E7 
Human Ortholog
ENSG00000108256 (NUFIP2)
Omim not available
UniTrap UNI5210
Vector Insertion
Chr 11: 77500010 - 77505043
Public Clones (sanger) YTC023 (baygenomics) CSH498 (baygenomics) P135A03 (ggtc)
PST22409-NR (escells) IST12265G12 (tigm)
Private Clones OST340022 (lexicon) OST281070 (lexicon) OST63802 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5378
Vector Insertion
Chr 11: 77506757 - 77519010
Public Clones XC697 (baygenomics) YHC305 (baygenomics) RST124 (baygenomics) SYA140 (baygenomics)
XC772 (baygenomics) XG095 (baygenomics) XE036 (baygenomics) YHC307 (baygenomics)
RST108 (baygenomics) A062B05 (ggtc) (ggtc) A059E02 (ggtc) A061D08 (ggtc)
PST5436-NR (escells)
Private Clones OST388281 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI483
Vector Insertion
Chr 11: 77519044 - 77523184
Public Clones DB0054 (sanger) RRN063 (baygenomics) HMA391 (baygenomics) PST15481-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14032
Vector Insertion
Chr 11: 77524260 - 77555187
Public Clones CMHD-GT_444A11-3 (cmhd) CMHD-GT_152D6-3 (cmhd) CMHD-GT_396F11-3 (cmhd) CMHD-GT_459A10-3 (cmhd)
IST12108G2 (tigm) IST13660G10 (tigm) IST11091H11 (tigm) IST11509G3 (tigm)
IST12571C4 (tigm) IST11669H10 (tigm) IST13754C10 (tigm) IST12719A5BBF1 (tigm)
IST14333G7 (tigm) IST14830B8 (tigm)
Private Clones OST468110 (lexicon) OST428663 (lexicon) OST416687 (lexicon) OST415240 (lexicon)
OST403521 (lexicon) OST389807 (lexicon) OST369988 (lexicon) OST368765 (lexicon)
OST368757 (lexicon) OST328628 (lexicon) OST315882 (lexicon) OST315014 (lexicon)
OST309396 (lexicon) OST308118 (lexicon) OST283755 (lexicon) OST257947 (lexicon)
OST250475 (lexicon) OST237135 (lexicon) OST230380 (lexicon) OST204553 (lexicon)
OST120742 (lexicon) OST120728 (lexicon) OST120723 (lexicon) OST120683 (lexicon)
OST120677 (lexicon) OST106648 (lexicon) OST86079 (lexicon) OST83727 (lexicon)
OST76248 (lexicon) OST67033 (lexicon) OST67032 (lexicon) OST31755 (lexicon)
OST31580 (lexicon) OST31385 (lexicon) OST29504 (lexicon) OST28563 (lexicon)
OST27974 (lexicon) OST27220 (lexicon) OST25971 (lexicon) OST24884 (lexicon)
OST23248 (lexicon) OST19448 (lexicon) OST18018 (lexicon) OST17481 (lexicon)
OST17367 (lexicon) OST16683 (lexicon) OST14634 (lexicon) OST14454 (lexicon)
OST14433 (lexicon) OST13002 (lexicon) OST12287 (lexicon) OST11886 (lexicon)
OST9649 (lexicon) OST8607 (lexicon) OST5312 (lexicon) OST3548 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036677
Sequence
AGATATACCGAGCGAGCGCGGAGAAGCAGTCTCAGATCCTGACGGTGCAGCAGCCCGCAGCCTCAGCCAGGGAGTCCCAGCCGCTTTCAATGGAGGAGAA

GCCCGGCCAGCCACAGCCTCAGCACCATCACAGCCACCACCATCCGCACCATCATCCCCAGCAGCAGCAGCAGCAGCAGTCGCACCACCACCACCATTAT

TATTTCTACAACCACAGCCACAACCACCACCACCACCACCATCACCAGCAGCCTCACCAATACCTGCAGCATGGAGCCGAGGGCAGCCCCAAGGCCCAGC

CCAAGCCGCTGAAACATGAGCAGAAACACACCCTCCAGCAGCACCAGGAAACGCCGAAGAAGAAAACAG - UNI5210 - GCTATGGTGAAATAAACG

GTAATGCTGGAGAAAGAGAAATATCTTTAAAGAGCCTCAGTTCTGATGAAGCTACCAACCCTATTTCCAGGGTCCTTAATGGCAACCAGCAAGTTGTAGA

AACAAGCCTGAAGCAGACTGTAAAGACCAGCACCTTTGGAAAAGCAGGAATCAAAACCAAGAATTTTATTCAGAAAAACAGTATGGACAAAAAGAATGGG

AAGTCTTATGAAAACAAATCTGGAGAGACCCAGGCTGTAGATAAGACCGATACCATAGCAATTCCAAATGGTGTTATAACAAGTAGTTCAGGCTATATTA

CTAATGGTTATATGAGCAAAGGAGCAGATAATGATGGTAGTGGATCTGAGAGTGGATATACCACTCCTAAAAAAAGGAAAGCTAGGCGCAATAGTGCCAA

GGGTTGTGAAAACCTTAATTTAGTGCAGGACAAAATAATGCAAGAGACTAGTGTCCCAGCATTAAAACAGGGACTTGAAACTTTAAAGCCTGACTATAGT

GAACAAAAGGGAATGCGAGTAGATGGTTCAAAGCCTATTTGGAAATATGAAACTGGACCTGGAGGAACAAGTCGTGGAAAACCTGCTATGGGTGACGTGC

TTCGTAAAAGCTCTGATATTAAACCTGGTTTGAGTAGCAAAAAATTTGATGATCGGCCTAAAGGAAAGCATGCCTCAGCTGCTGCCTCCAAAGAGGACTC

ATGGACCTTGTTTAAGCCACCCCCAGTTTTTCCAGTGGACAATAGCAGTGCAAAAATAGTTCCTAAAATAAGTTATGCAAGCAAAGTTAAGGAAAACCTC

AACAAAACTGTACAGAACTCCTCCGTGTCACCATCTTCATCTTCATCATCATCATCTACTGGGGAAACTCAGACCCAGTCTTCAAGTCGGTTATCCCAGG

TCCCGATGTCAGCTCTGAAATCTGTTACTTCTGCCAGTTTTTCTAATGGGCCTGTTTTAGCAGGAACTGATGGAAGTGTGTACCCATCTGGGGGTCAGCC

ACTGCTAACGACTGCTGCTAATACTTTAACACCCATCTCTACTGGGACTGATTCTGTTCTTCAGGACATGAGTCTGGCTTCAGCAGCCGTTGAACAAATT

AAATCTAGCCTTTTTATCTACCCTTCAAATATGCAAACAGTGCTGTTAAGTGCACAAGTAGATCTGCCCTCTCAGACAGATCAGCAAAACCTGGGGGATA

TCTTCCAGAATCAATGGGGTTTATCATTTATAAATGAGCCCAGTGCTGGCCCAGAGACTGTTATTGGAAAGTCATCAGATCATAAAGTGATGGAAGTGAC

ATTTCAAGGAGAATATCCTGCCACTTTGGTTTCACAGGGTGCTGAAATAATTCCCTCAGGAACTGAGCATCCTGTGTTTCCCAAGGCTTATGAGCTGGAA

AAACGGACTAGTCCTCAAGTTCTGGGTCACATTCTAAAACCTGGGACTACTGAGAGTGGAGCCTTATCCTTGGACCCCAGTCATATAGGTGACCTGCAAA

AAGCAGACACCAGTAGTCAAGGTGCTTTAGTGTTTCTCTCAAAGGACTACGAAATAGAAAATCAAAATCCCCTGGCCTCTCCTACGAACACTTTGTTAGG

CTCCGCCAAAGAACAGAGATACCAGAGAGGCCTAGAAAGGAATGATAGCTGGGGTTCTTTTGACCTGAGGGCTGCTATTGTATATCACACTAAAG - UN

I5378 - AAATGGAATCTATATGGAATTTGCAGAAGCAAG - UNI483 - - UNI14032 - TGTTTTGCCTGTGTGTATATATGTACACGTATGT

ACACCATGTCATGAGCCTCCATGGTCGTGAGAGGACTTTGGATCCCTTGGAACTGGCGTTACATTGGTCGTGA
Translation
MEEKPGQPQPQHHHSHHHPHHHPQQQQQQQSHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKPLKHEQKHTLQQHQETPKKKTG - UNI

5210 - GYGEINGNAGEREISLKSLSSDEATNPISRVLNGNQQVVETSLKQTVKTSTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGETQAVDKTDTIA

IPNGVITSSSGYITNGYMSKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNLVQDKIMQETSVPALKQGLETLKPDYSEQKGMRVDGSKPIWKYETGP

GGTSRGKPAMGDVLRKSSDIKPGLSSKKFDDRPKGKHASAAASKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTVQNSSVSPSSSSSSSST

GETQTQSSSRLSQVPMSALKSVTSASFSNGPVLAGTDGSVYPSGGQPLLTTAANTLTPISTGTDSVLQDMSLASAAVEQIKSSLFIYPSNMQTVLLSAQV

DLPSQTDQQNLGDIFQNQWGLSFINEPSAGPETVIGKSSDHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPKAYELEKRTSPQVLGHILKPGTTESG

ALSLDPSHIGDLQKADTSSQGALVFLSKDYEIENQNPLASPTNTLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKE - UNI5378 - EMESIWNL

QKQV - UNI483 - - UNI14032 - VFCLCVYMYTYVHHVMSLHGRERTLDPLELALHWS
Transcript ENSMUST00000100802
Sequence
AGATATACCGAGCGAGCGCGGAGAAGCAGTCTCAGATCCTGACGGTGCAGCAGCCCGCAGCCTCAGCCAGGGAGTCCCAGCCGCTTTCAATGGAGGAGAA

GCCCGGCCAGCCACAGCCTCAGCACCATCACAGCCACCACCATCCGCACCATCATCCCCAGCAGCAGCAGCAGCAGCAGTCGCACCACCACCACCATTAT

TATTTCTACAACCACAGCCACAACCACCACCACCACCACCATCACCAGCAGCCTCACCAATACCTGCAGCATGGAGCCGAGGGCAGCCCCAAGGCCCAGC

CCAAGCCGCTGAAACATGAGCAGAAACACACCCTCCAGCAGCACCAGGAAACGCCGAAGAAGAAAACAG - UNI5210 - GCTATGGTGAAATAAACG

GTAATGCTGGAGAAAGAGAAATATCTTTAAAGAGCCTCAGTTCTGATGAAGCTACCAACCCTATTTCCAGGGTCCTTAATGGCAACCAGCAAGTTGTAGA

AACAAGCCTGAAGCAGACTGTAAAGACCAGCACCTTTGGAAAAGCAGGAATCAAAACCAAGAATTTTATTCAGAAAAACAGTATGGACAAAAAGAATGGG

AAGTCTTATGAAAACAAATCTGGAGAGACCCAGGCTGTAGATAAGACCGATACCATAGCAATTCCAAATGGTGTTATAACAAGTAGTTCAGGCTATATTA

CTAATGGTTATATGAGCAAAGGAGCAGATAATGATGGTAGTGGATCTGAGAGTGGATATACCACTCCTAAAAAAAGGAAAGCTAGGCGCAATAGTGCCAA

GGGTTGTGAAAACCTTAATTTAGTGCAGGACAAAATAATGCAAGAGACTAGTGTCCCAGCATTAAAACAGGGACTTGAAACTTTAAAGCCTGACTATAGT

GAACAAAAGGGAATGCGAGTAGATGGTTCAAAGCCTATTTGGAAATATGAAACTGGACCTGGAGGAACAAGTCGTGGAAAACCTGCTATGGGTGACGTGC

TTCGTAAAAGCTCTGATATTAAACCTGGTTTGAGTAGCAAAAAATTTGATGATCGGCCTAAAGGAAAGCATGCCTCAGCTGCTGCCTCCAAAGAGGACTC

ATGGACCTTGTTTAAGCCACCCCCAGTTTTTCCAGTGGACAATAGCAGTGCAAAAATAGTTCCTAAAATAAGTTATGCAAGCAAAGTTAAGGAAAACCTC

AACAAAACTGTACAGAACTCCTCCGTGTCACCATCTTCATCTTCATCATCATCATCTACTGGGGAAACTCAGACCCAGTCTTCAAGTCGGTTATCCCAGG

TCCCGATGTCAGCTCTGAAATCTGTTACTTCTGCCAGTTTTTCTAATGGGCCTGTTTTAGCAGGAACTGATGGAAGTGTGTACCCATCTGGGGGTCAGCC

ACTGCTAACGACTGCTGCTAATACTTTAACACCCATCTCTACTGGGACTGATTCTGTTCTTCAGGACATGAGTCTGGCTTCAGCAGCCGTTGAACAAATT

AAATCTAGCCTTTTTATCTACCCTTCAAATATGCAAACAGTGCTGTTAAGTGCACAAGTAGATCTGCCCTCTCAGACAGATCAGCAAAACCTGGGGGATA

TCTTCCAGAATCAATGGGGTTTATCATTTATAAATGAGCCCAGTGCTGGCCCAGAGACTGTTATTGGAAAGTCATCAGATCATAAAGTGATGGAAGTGAC

ATTTCAAGGAGAATATCCTGCCACTTTGGTTTCACAGGGTGCTGAAATAATTCCCTCAGGAACTGAGCATCCTGTGTTTCCCAAGGCTTATGAGCTGGAA

AAACGGACTAGTCCTCAAGTTCTGGGTCACATTCTAAAACCTGGGACTACTGAGAGTGGAGCCTTATCCTTGGACCCCAGTCATATAGGTGACCTGCAAA

AAGCAGACACCAGTAGTCAAGGTGCTTTAGTGTTTCTCTCAAAGGACTACGAAATAGAAAATCAAAATCCCCTGGCCTCTCCTACGAACACTTTGTTAGG

CTCCGCCAAAGAACAGAGATACCAGAGAGGCCTAGAAAGGAATGATAGCTGGGGTTCTTTTGACCTGAGGGCTGCTATTGTATATCACACTAAAG - UN

I5378 - AAATGGAATCTATATGGAATTTGCAGAAGCAAG - UNI483 - ATCCCAAAAGGATAATCACTTACAATGAAGCCATGGATAGTCCAGAT

CAATGAAGGACCAGACTGCCTATTTGTAATCTTTCTGCAGCATTAGAGCCACCGTTCATGTGGGACACAAGGCTTTTATGCTCCTAGATCTTCAACGCAG

CAGAGGAACCATAAGTAGAATCACAGGATAATATATACAAATATATATATATATATACATATATATATATAGTTATTTAAAAAAAGGCAACTGAAAGTAA

TTAGACTTCTTAAGGAATCAAATTTATTTCAAGAGACTACACATGGTTATTTAATCTCCGGTACTGAATAGTCCTTTTCTTTATTATTTTGTTAGTTTTT

GTTTTTAAGTGTGAATGCAAGTGATTAATGAATACAGACTTAACAAGCGTGGTTCTAAAGTTCCTGCTGTCATCTACTTGGGCAACAAATGACCCACTGG

AAAGGCAAATCCACTTACTTCTAGGTATCTGTACCTTGTTCTGTGACTAAAGTGATACACTAATCACGGGGAACCCAGAATGATTCAACATTTTCCCCTA

CTCCACCCTTGATCTTTTAGTTTTGAGCCCTGCGAGAATGCTGGATAAATGCCTTGAAGTTTGCAGGGATGTTTTTTGTTGTTTGTTTTTTGTTGGTTTT

TTTTTGTTTGTTTTAATACAATGATTTGCATGTCTTGCCAAGAGTTCTGCAGCCTATGTGGGGTGTTGGGGAAATAGTTCCTTTCCTTTTATTTTTTGTT

GGGTGGGGACAGGGGGAGGGCATTGAAGTTCTACAATCCTGGAATAGTTTGTGGGTATATAGTTAACTTACTTTGGTTACATGTTTGGACTTTTAACATC

TAAGAGTGTCATTCAAAAAAAAGTTGCAGAACAAGTAATTGGCTGATAATTACCCATTGTAATTGTGTAACTGGGAGCAAAAATATATTCTGCTTTTCTG

CTGTAGGTGCTCTGACTTGCTCTCTGTCACTAACACTAAGTGTATACTCTTGTTTTTCATCAACCATTTAAGAGAAACGTATGTACCTTTCTGTAAATTC

TTTTAATTTCAGTTTCTCAGCAAAATCG
Translation
MEEKPGQPQPQHHHSHHHPHHHPQQQQQQQSHHHHHYYFYNHSHNHHHHHHHQQPHQYLQHGAEGSPKAQPKPLKHEQKHTLQQHQETPKKKTG - UNI

5210 - GYGEINGNAGEREISLKSLSSDEATNPISRVLNGNQQVVETSLKQTVKTSTFGKAGIKTKNFIQKNSMDKKNGKSYENKSGETQAVDKTDTIA

IPNGVITSSSGYITNGYMSKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNLVQDKIMQETSVPALKQGLETLKPDYSEQKGMRVDGSKPIWKYETGP

GGTSRGKPAMGDVLRKSSDIKPGLSSKKFDDRPKGKHASAAASKEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTVQNSSVSPSSSSSSSST

GETQTQSSSRLSQVPMSALKSVTSASFSNGPVLAGTDGSVYPSGGQPLLTTAANTLTPISTGTDSVLQDMSLASAAVEQIKSSLFIYPSNMQTVLLSAQV

DLPSQTDQQNLGDIFQNQWGLSFINEPSAGPETVIGKSSDHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPKAYELEKRTSPQVLGHILKPGTTESG

ALSLDPSHIGDLQKADTSSQGALVFLSKDYEIENQNPLASPTNTLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKE - UNI5378 - EMESIWNL

QKQD - UNI483 - DPKRIITYNEAMDSPDQ

For any suggestions or comments, please send an email to unitrap@crg.es