Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037876 (Jmjd1c)
Chromosomal location
Chr 10: 66648728 - 66719066 (+)
Description
jumonji domain containing 1C Gene [Source:MGI Symbol;Acc:MGI:1918614]
UniGene
Mm.417464 Mm.473497 Mm.23846 
MGI
MGI:1918614 
Uniprot/SWISSPROT
Q69ZK6 
Human Ortholog
ENSG00000171988 (JMJD1C)
Omim not available
UniTrap UNI14486
Vector Insertion
Chr 10: 66649060 - 66652483
Public Clones (sanger) P133F12 (ggtc) D098A03 (ggtc) H008D09 (ggtc) D029E02 (ggtc)
P149H07 (ggtc) H003G12 (ggtc) P100A06 (ggtc) D045D06 (ggtc) P093A04 (ggtc)
D009H12 (ggtc) FHCRC-GT-S10-8B1 (fhcrc) FHCRC-GT-S17-7C1 (fhcrc) FHCRC-GT-S1-3E1 (fhcrc)
IST14147D2 (tigm) IST14207D12 (tigm) IST10846A12 (tigm) IST14338B1 (tigm)
IST13303D9 (tigm) IST10684G12 (tigm) IST14681C3 (tigm) IST14424B9 (tigm)
IST10491H9 (tigm) IST15007A1 (tigm) IST14325F1 (tigm) IST14357B5 (tigm)
IST10034B4 (tigm) IST13247A4 (tigm) IST14405A9 (tigm) IST14947G3 (tigm)
Private Clones OST389850 (lexicon) OST339145 (lexicon) OST329043 (lexicon) OST290632 (lexicon)
OST290552 (lexicon) OST279229 (lexicon) OST199333 (lexicon) OST185230 (lexicon)
OST55131 (lexicon) OST44822 (lexicon) OST40146 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI569
Vector Insertion
Chr 10: 66652598 - 66678017
Public Clones BB0565 (sanger) (sanger) DA0191 (sanger) AW0305 (sanger) RST276 (baygenomics)
RRS338 (baygenomics) Ex182 (baygenomics) TEA171 (baygenomics) D028B08 (ggtc)
P118H06 (ggtc) PST4379-NL (escells)
Private Clones OST456267 (lexicon) OST377377 (lexicon) OST208419 (lexicon) OST186195 (lexicon)
OST83418 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7078
Vector Insertion
Chr 10: 66686930 - 66687484
Public Clones RRZ026 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6410
Vector Insertion
Chr 10: 66708905 - 66710758
Public Clones CSA003 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095573
Sequence
TTGTAATCCGCAGCACTGCCAGGGCTGAGCCGGGCAGACAGAAAATCGTCATTTGCTGCTCACAGGCTTGTTAGGTTACAGCCTCTGCTTCGTTCTGTGG

TCTTGGCTTTTCTTCCTATACAATGACGGCGCTGCAAGTGAGCTCAGAAATGCTTGGTTTGAAAGCCATTTGCCTGTGATTGTTTTTGAAGACTAAAGAA

GTATTTATGCTCGATTAAAAAAATACTGCTCACGAACAAAATGAAATGCCAGCTATATTTACTGACCTTTAAAGCCTTGGCTTGGATTGCTGAGATTTAA

AGATACTTTAAAATTCTCAAGAACTAAGTACG - UNI14486 - ACCTTCAAACCATTGGTTGAAAATAGTATACCTAGTTCTATCACTGCAGTAGAA

TTCCTTATAGATAAGCAACTGGATTTTTTAACAGAAGATAGTGCCTTTCAGCCATACCAG - UNI569 - GACGACATAGACAGCTTAAAGCCCGTAC

TCAGGGACAACCCACAGCTGCACGCGGAAGTGAAAGTCTGGGTGAAGGAACAGAAGGTCCAGGAGATTTTTATGCAAG GTCCTTATTCATTAAATGGAT

ACAGAGTGAGAGTCTATAGACAAGATTCTGCCACCCAGTGGTTTACTGGCATAATTACTCATCATGATCTCTTCACCCGCACCATGATCGTTATGAATGA

TCAG GTACTAGAACCACAGAATGTCGATCCTTCTATGGTTCAAATGACCTTTCTAGATGATGTCGTTCACTCTTTGTTAAAAGGTGAAAATATTGGCAT

TACATCACGGCGAAGGTCTCGTGCCAGTCAAAATATCAGCACTGTTCAC GGTCATTATACACGTGCTCAAGCAAATAGTCCCAGACCAGCAATGAACTC

TCAAGCTGCTGTACCAAAACAGAACACACACCAGCAACAGCAACAAAGAAGTATTCGTCCAAATAAGAGGAAGGGTTCAGATAGCAGCATACCCGATGAA

GAGAAGATGAAGGAAGATAAATATGATTGTGTATCACGAGGAG AAAATCCTAAAGGTAAGAACAAGCACGTGGTGACAAAACGGCGGAAACCTGAGGAG

GCCGAGAAGAGGCTGAGCATGAAAAGGCTCCGGACAGACAATGCCTCTGACGCCTCCGAGAGCAGTGACGCAGAGAGCTCCAGCAAGAGAGTGACTGAGA

CTTCCTCCTCTGAACCAATGCCAGAGTATGAACCGAAAAATAAAGTCACCTCAAAGGTAAATGGAGAGGAGGGACAGTCCCAGGCTGCTGAAGAGGCAGG

AGAAGAGACCCTGATAGATACTCGGCCTCCCTGGGACCAGATGCAGGAAGATAAAAACCACAACGAAGGGGAGAAGCCCAAGTCCACGGACAGCCACCTT

CAAGACAAAATGACTCTCCGTTCATCTGAGCAAGCCACAGTTGCTGACCACAATTCTAATGATTCAGTCCTTCAAGAATGCAATGTGGAAAACCAACGCA

CAGTGGAATTATTACCAAAGGACAGGTTAGTGTCCAGAACACCGACACCCAAATGTGTTACGGATATCAAGAACGACACTCATTCTGAGAGGGCGGCTCA

GGAAAATTTAAATACTTTTGGCCTCCAGACACCTGAGAACATGGATCCAAATGTTAGTGATTCCAAACATTCAAATGCTAAATACCTAGAAACAGCAAAG

CAAGATTGTGACCAGAGCTGGGTCAGTGATGTAGTGAAAGTGGATTTAACTCAGTCAAGTGTTACAAATGCTCCTTCAGGAAGTGATAAGCGCGATACGG

AGAAAGAGAGAAATCACTATGTCTCATACATGTCTTCATTAAGTGCAGTTTCTGTCACAGAGGATCAGCTACATAAACGAAGTCCACCCCCAGAAACTAT

AAAAGCTAAACTAACTACTTCAGTAGATACCCAGAAGGCAAAATCCAGTTCTTCACCTGAAGTTGTTAAACCCAAGATCACTCATTCTCCTGATTCTGTG

AAGTCTAAAGCTGCTTATGGGAACAGTCAAGCTGTTGGTGAGCGAAGGCTGGCAAATAAAATAGAGCATGAGTTATCCAGAGGTAGTTTCCATCCAGTTC

CTACTCGAGGCAGTGCTTTGGAAACTACAAAGAGCCCTCTTATCATTGATAAAAACGAGCACTTCACAGTCTATAGGGATCCTGCTCTTATTGGATCAGA

AACAGGAGCTAATCACATTTCACCTTTTTTGAGCCAGCATCCTTTTTCTCTTCATTCCTCATCCCATAGAACCTGTTTAAACCCAGGTACCCATCACCCT

GCCTTAACGCCAGGACCCCACTTACTAGCTGGGTCAACTAGTCAAACTCCATTACCTACCATTAACACTCACCCTCTCACTAGTGGTCCACACCATCCTG

TCCATCACCCTCATTTGCTTCCCACTGTGTTACCTGGAGTGCCTACTGCCTCTTTACTCGGTGGCCACCCACGTCTAGAGAGTGCTCATGCAAGCAGCTT

GAGCCATTTAGCACTAGCACACCAGCAGCAGCAACAGTTGTTACAGCACCAGTCACCTCATCTTCTTGGACAAGCCCATCCTTCCGCTTCATATAATCAG

CTTGGACTTTATCCAATTATTTGGCAATATCCGAATGGAACACATGCATACTCAGGACTTGGTCTCCCTTCTTCTAAGTGGGTTCACCCAGAAAATGCAG

TTAATGCTGAAGCTTCATTAAGGAGG AATTCTCCCAGTCCTTGGCTACATCAACCCACTCCTGTGACCTCAGCGGATGGTATTGGATTACTTAGTCACA

TTCCTGTCAGACCTTCCAGTGCAGAGCCTCATCGACCTCACAAGATTACAGTGCATTCCAGTCCCCCACTGACAAAGACATTAGCAGATCACCACAAAGA

 - UNI7078 - AGAATTGGAGAGGAAAGCTTTTATGGAACCATTACGGTCTAATGCATCCACATCAGTAAAAGGTGACCTGGATCTTAATAGGTCACA

GGCAGGAAAAGATTGTCACTTGCATAGGCATTTTGTGGGTCCAAGGCCACCCCAGGAGACTGGAGAGAGACTGAACAAATACAAGGAGGAACATCGTCGG

ATTCTTCAGGAGAGTATTGATGTGGCTCCATTTACAACCAAAATCAAGGGTCATGAGGTTGAAAGAGAGAATTACTCCAGAGTAGTACCATCATCTTCTA

GTCCTAAAAGCCATGCTATCAAACAAGATAAAGACGTAGACCGCTCCGTGTCAGAGATTTATAAGATGAAGCACTCAGTGCCTCAGAGTTTGCCCCAGAG

TAACTACTTCACTACTTTATCTAATAGTGTGGTCAATGAGCCACCAAGATCCTACCCATCCAAAGAAGTTTCCAACATTTACACTGAGAAACAAAATAAT

AACCTTTCTGCAACAGCCAATCCTCAAACTCATTCTTTTATATCATCTCTTTCGAAGCCTCCACCTTTGATTAAACACCAACCAGAAAGTGAAAGTTTAG

TGGGCAAGATACCAGACCATCTTCCCCATCAGAGTGCATCTCACTCAGTAACAACGTTCAGAAGTGATTGTCGGAGCCCTACCCATCTGACTGTTTCTTC

TACTAATGCACTCCGCAGCATGCCTGCTCTGCACAGGGCACCAGTATTCCATCCACCAATCCACCACAGTTTGGAAAGAAAGGAAAGCAGCTACAGTAGC

CTTTCCCCTCCAACACTGACACCGGTGATGCCAGTAAATGCTGGTGGCAAAGTTCAAGAATCTCAGAAGCCTCCAACTCTAATTCCTGAGCCAAAAGACT

CTCAGTCAAATTTTAAGAATTCTTCTGATCAGAGTCTAACGGAAATGTGGAGATCTAATAACAACCTCAACAGAGAGAAAGCTGAGTGGCCCGTGGAAAA

GAGTAGTGGAAAGTCCCAGGCTGCTGTGGCATCTGTCATTGTTCGTCCACCTTCTAGTACAAAAGTTGATAGTGTGCCATCTGTACCATTAGCTTCCAAA

GATCGAGTTTGTGAAAGATCTTCATCTGGGGCAAATAAAACAGATTACCTCAAACCAGAAGCCGGAGAGACTGGAAGAATTATTCTACCAAATGTGAATT

TAGAAAGTGCTCATGTGAAATCTGAAAAAAACTTTGAAGCTGTCTCCCAGGGCAACGTTCCTGTTTCAGTCATGTCTGCTGTAAATGTAGTCTCTACTAC

CAAAGCAGATGTGTTCACATCTGCTGCCACTACCACCAGTGTCTCCAGCTTGAGTAGTGCAGAAACAAGTTATTCTTTATCAAATACCATTTCGGCCTCT

ACACCCTTCGAATGTACTTCTTCAAAAAGTGTTGTTAGTCAGGCAGTGGCGCAAGCAAAGGACTGCACAGTCAGCACCGCGGTTCCAGGCACTCTGGCCT

GTAGTAAGACAGGAAGTGCTGTTCAGCCCGGCTCTGGCTTCTCAGGCACAACTGATTTTATTCATTTAAAAAAGCACAAGGCAGCGTTGGCTGCAGCTCA

GTTTAAAAATAGTAGTGTCAGTGAGGCTGAACTTAATACTGTGAGAAATCAGACAGTGGCAGCCTCTCTTCCCCTGGATAGCACCATGACCTGCACTGCA

AGTAACAAAGCAATCTCTGTAGGAAATGGGCCAGCAGCCCAGTCCAGTCAGCCCAACTACCACACTAAACTGAAGAAGGCCTGGCTCACCAGACATTCAG

AAGAAGATAAAAATACTAATAAAATGGAAAATTCAGGGAATTCTGTATCCGAAATTATTAAGCCATGTTCTGTCAACTTAATAGCCTCTACATCTAATGA

TATAGAAAATCGTGCAGATGGCAGAGTCGCTGTAGATAAATATGGAAGAGATGAGAAAGTCAGCAGGAGAAAAGCCAAAAGAACTTACGAATCTGGCTCT

GAAAGTGGAGACTCAGATGAGAGCGAAAGCAAGTCGGAGCAGAGGACTAAACGGCAGCCGAAGCCAACTTATAAAAAGAAGCAGAACGACCTGCAGAAGA

GGAAAGGCGAGGTCGAAGAGGACTCGAAGCCTAATGGAGTTCTCAGCAGGAGCGCCAAGGACAAAAGTAAACTGAAGTTGCAGAACAGTAATAGCG CTG

GCGTTCCTCGTTCCGTGCTGAAAGACTGGCGGAAGGTCAAGAAGCTGAAGCAAACTGGAGAATCATTTCTGCAGGATGACTCCTGCTGTGAGATAGGTCC

CAACTTACAGAAGTGCCGAGAGTGCAGACTTATCCGGAGTAAGAAGGGGGAAGAATCAACTCACTCACCGGTGTTTTGTAGATTTTACTACTTTAGGAG 

ATTGTCCTTTAGTAAGAATGGAGTAGTCAGAATAGATGGTTTCTCTTCTCCTGATCAATACGATGATGAAGCCATGAGTTTATGGACCCATGAAAATTAT

GAAGATGATGAAGTAGATGTTGAAACCTCTAAGTATATCTTGGACATAATAGGTGATAAGTTCTGTCAGTTAGTAACGTCTGAGAAAACAGCGTTGTCCT

GGGTGAAAAAGGATG CCAAAATTGCATGGAAAAGGGCAGTTCGAGGTGTCCGGGAGATGTGTGATGCGTGCGAGGCCACACTGTTCAACGTCCACTGGG

TTTGCCGCAAGTGTGGATTTGTGGCTTGCTTGGACTGTTACAAGGCCAAGGAAAGGAAGAGTTCTAGAG ATAAAGAGCTGTATGCTTGGATGAAGTGTG

TGAAAGGCCAGCCCCATGACCATAAGCATCTGATGCTGACTCAGATTATCCCTGGCTCTG TGTTGACAGACCTTCTTGATGCCATGCACATTCTTAGGG

AAAAATATGGTATTAAATCCCATTGTCACTGTACAAACAGACAGAATTTACAAGGTGGAAATGTTCCTACAATGAATGGTGTGTCTCAA GTTCTACAGA

ATGTTCTTCACCACAGTAATAAGACTTCTGTGTCCCTGCCTGAGTCTCAGCAGCAGAACAGCCCTCAGAAATCTCAGACTAACGGCAACAGTAGCCCTGG

AAGTGCAAGTACAGACAGCAGGTTGACACCTCCAGAGTCCCAGTCACCGCTGCACTGGCTAGCTGATCTTG GACCCAGGCTGTGCAGTGCCTATG GTG

TTGCTGCTGCTAAGGATCATGATATAGGAACCACAAATCTTCACATTGAAGCTTCTGATGTTGTCAATGTCCTAGTCTATGTCGGCATAGCAAAAGGAAA

TGGCGTCCTCTCAAAAGCAG - UNI6410 - GAATACTTAAGAAATTTGAAGAAGAAGAATTAGATGATGTTTTAAGAAAAAGATTAAAGGATTCGAG

TGAAATCCCTGGTGCTCTATGGCATATTTATGCTGGAAAAGATGTTGACAAGATAAGGGAATTTCTTCAAAAG ATTTCAAAAGAACAAGGCCTTGAAGT

TCTGCCAGAGCATGATCCAATCCGGGACCAAAGCTGGTATGTGAATAGAAAGCTCCGCCAGAGACTGCTTGAGGAATATGGGGTGAGAGCCTGCACTCTG

ATTCAGTTCCTTGGTGATGCCATTGTTTTGCCAGCAGGAACACTTCACCAG GTACAAAATTTTCACAGCTGTGTTCAGGTGACCGAAGACTTTGTCTCT

CCAGAACATCTTGTACAGTCGTTTCACTTAACACAGGAGCTGAGGCTTTTGAAGGAAGAAATCAATTACGATGATAAACTCCAG GTTAAGAATATCTTG

TATCATGCAGTCAAGGAAATGGTGAGAGCTCTGAAGATGCATGAAGATGAAGTAGAGGATATGGAAGACACCTAATTGCGGTTGGAACTGGGATGCCCCT

TGAGTGACGCTAGGTCTGACTTAAGCTCCATTAAACCATCAGTGCCAAGAAATTCTCTTTGTAGTAATTACTTGCTACTGACACCATACCAGTATAGCAT

TATGCCACAGCCCCTGTGATTCAATGCTAGCTATAAACCAAGCTAAATTTAAAAGCAGTACTATATAGCTGTTCCTGTATCATAGTGTATATGATGTTTG

TGAAGATGCCAGATTTAAAATGATGTATTTATTTTTGGTAAAAAAAAAAATCTATGCTATATTGTTGATCAAGTGTAAATGTGCTGTTGTACAGTTTAAT

AAAATAACTGATATTTTTCACTACATTGAGACAGTTACTGTGAGACTAGGACACACCAGCTGTTGCCTGCGTTTGGGAAATTGCTGGATTGCACAGCAGT

CACGTCATAATCAGAAAATTACTGCCAAATAATTGTAAAATGTGTAAAATACAAAGTACATAAAGTAGATACTAAACTCAGACACTTCAATATTTTGTTG

AAGCTATTGACTGTACAATTAAACGTTTTCAAAAGGTGTAATTTATTTAAAATTGTCTCATTTTGGTAAAATTTATGTGAAGTTTTAAAGCTAAATATTA

AACTTAATATGCTATGTAAATATATACATATATACATTTAAGGATGTATTTTTTTAAAACATTGGCTTGCTTTTGTTAAAGTGCAAGTGTTACATATGGC

TTTGTACATTACAGTTGAAAGGGGTTTTACATTTTCCATTAAAAGACTTTATCAAG
Translation
 - UNI14486 -  - UNI569 - MQG GPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQ VLEPQNVDPSMVQMTFLDDVVHSLLKG

ENIGITSRRRSRASQNISTVH GHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGE ENPKGKNKHVVT

KRRKPEEAEKRLSMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEYEPKNKVTSKVNGEEGQSQAAEEAGEETLIDTRPPWDQMQEDKNHNEGEKP

KSTDSHLQDKMTLRSSEQATVADHNSNDSVLQECNVENQRTVELLPKDRLVSRTPTPKCVTDIKNDTHSERAAQENLNTFGLQTPENMDPNVSDSKHSNA

KYLETAKQDCDQSWVSDVVKVDLTQSSVTNAPSGSDKRDTEKERNHYVSYMSSLSAVSVTEDQLHKRSPPPETIKAKLTTSVDTQKAKSSSSPEVVKPKI

THSPDSVKSKAAYGNSQAVGERRLANKIEHELSRGSFHPVPTRGSALETTKSPLIIDKNEHFTVYRDPALIGSETGANHISPFLSQHPFSLHSSSHRTCL

NPGTHHPALTPGPHLLAGSTSQTPLPTINTHPLTSGPHHPVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQSPHLLGQAH

PSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRR NSPSPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTK

TLADHHKE - UNI7078 - EELERKAFMEPLRSNASTSVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIK

GHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISS

LSKPPPLIKHQPESESLVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVFHPPIHHSLERKESSYSSLSPPTLTPVMPVNAGG

KVQESQKPPTLIPEPKDSQSNFKNSSDQSLTEMWRSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRVCERSSSGANKTDY

LKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNVVSTTKADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAV

AQAKDCTVSTAVPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVRNQTVAASLPLDSTMTCTASNKAISVGNGPAAQSS

QPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGSESGDSDESESKSEQRT

KRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLKLQNSNSA AGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSK

KGEESTHSPVFCRFYYFRR RLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSKYILDIIGDKFCQLVTSEKTALSWVKKDA AKIAWK

RAVRGVREMCDACEATLFNVHWVCRKCGFVACLDCYKAKERKSSRD DKELYAWMKCVKGQPHDHKHLMLTQIIPGSV VLTDLLDAMHILREKYGIKSH

CHCTNRQNLQGGNVPTMNGVSQ VLQNVLHHSNKTSVSLPESQQQNSPQKSQTNGNSSPGSASTDSRLTPPESQSPLHWLADLG GPRLCSAYG GVAAA

KDHDIGTTNLHIEASDVVNVLVYVGIAKGNGVLSKAG - UNI6410 - GILKKFEEEELDDVLRKRLKDSSEIPGALWHIYAGKDVDKIREFLQK IS

KEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQFLGDAIVLPAGTLHQ VQNFHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDK

LQ VKNILYHAVKEMVRALKMHEDEVEDMEDT
Transcript ENSMUST00000051446
Sequence
TTGTAATCCGCAGCACTGCCAGGGCTGAGCCGGGCAGACAGAAAATCGTCATTTGCTGCTCACAGGCTTGTTAGGTTACAGCCTCTGCTTCGTTCTGTGG

TCTTGGCTTTTCTTCCTATACAATGACGGCGCTGCAAGTGAGCTCAGAAATGCTTGGTTTGAAAGCCATTTGCCTGTGATTGTTTTTGAAGACTAAAGAA

GTATTTATGCTCGATTAAAAAAATACTGCTCACGAACAAAATGAAATGCCAGCTATATTTACTGACCTTTAAAGCCTTGGCTTGGATTGCTGAGATTTAA

AGATACTTTAAAATTCTCAAGAACTAAGTACG - UNI14486 - ACCTTCAAACCATTGGTTGAAAATAGTATACCTAGTTCTATCACTGCAGTAGAA

TTCCTTATAGATAAGCAACTGGATTTTTTAACAGAAGATAGTGCCTTTCAGCCATACCAG - UNI569 - GACGACATAGACAGCTTAAAGCCCGTAC

TCAGGGACAACCCACAGCTGCACGCGGAAGTGAAAGTCTGGGTGAAGGAACAGAAGGTCCAGGAGATTTTTATGCAAG GTCCTTATTCATTAAATGGAT

ACAGAGTGAGAGTCTATAGACAAGATTCTGCCACCCAGTGGTTTACTGGCATAATTACTCATCATGATCTCTTCACCCGCACCATGATCGTTATGAATGA

TCAG GTACTAGAACCACAGAATGTCGATCCTTCTATGGTTCAAATGACCTTTCTAGATGATGTCGTTCACTCTTTGTTAAAAGGTGAAAATATTGGCAT

TACATCACGGCGAAGGTCTCGTGCCAGTCAAAATATCAGCACTGTTCAC GGTCATTATACACGTGCTCAAGCAAATAGTCCCAGACCAGCAATGAACTC

TCAAGCTGCTGTACCAAAACAGAACACACACCAGCAACAGCAACAAAGAAGTATTCGTCCAAATAAGAGGAAGGGTTCAGATAGCAGCATACCCGATGAA

GAGAAGATGAAGGAAGATAAATATGATTGTGTATCACGAGGAG AAAATCCTAAAGGTAAGAACAAGCACGTGGTGACAAAACGGCGGAAACCTGAGGAG

GCCGAGAAGAGGCTGAGCATGAAAAGGCTCCGGACAGACAATGCCTCTGACGCCTCCGAGAGCAGTGACGCAGAGAGCTCCAGCAAGAGAGTGACTGAGA

CTTCCTCCTCTGAACCAATGCCAGAGTATGAACCGAAAAATAAAGTCACCTCAAAGGTAAATGGAGAGGAGGGACAGTCCCAGGCTGCTGAAGAGGCAGG

AGAAGAGACCCTGATAGATACTCGGCCTCCCTGGGACCAGATGCAGGAAGATAAAAACCACAACGAAGGGGAGAAGCCCAAGTCCACGGACAGCCACCTT

CAAGACAAAATGACTCTCCGTTCATCTGAGCAAGCCACAGTTGCTGACCACAATTCTAATGATTCAGTCCTTCAAGAATGCAATGTGGAAAACCAACGCA

CAGTGGAATTATTACCAAAGGACAGGTTAGTGTCCAGAACACCGACACCCAAATGTGTTACGGATATCAAGAACGACACTCATTCTGAGAGGGCGGCTCA

GGAAAATTTAAATACTTTTGGCCTCCAGACACCTGAGAACATGGATCCAAATGTTAGTGATTCCAAACATTCAAATGCTAAATACCTAGAAACAGCAAAG

CAAGATTGTGACCAGAGCTGGGTCAGTGATGTAGTGAAAGTGGATTTAACTCAGTCAAGTGTTACAAATGCTCCTTCAGGAAGTGATAAGCGCGATACGG

AGAAAGAGAGAAATCACTATGTCTCATACATGTCTTCATTAAGTGCAGTTTCTGTCACAGAGGATCAGCTACATAAACGAAGTCCACCCCCAGAAACTAT

AAAAGCTAAACTAACTACTTCAGTAGATACCCAGAAGGCAAAATCCAGTTCTTCACCTGAAGTTGTTAAACCCAAGATCACTCATTCTCCTGATTCTGTG

AAGTCTAAAGCTGCTTATGGGAACAGTCAAGCTGTTGGTGAGCGAAGGCTGGCAAATAAAATAGAGCATGAGTTATCCAGAGGTAGTTTCCATCCAGTTC

CTACTCGAGGCAGTGCTTTGGAAACTACAAAGAGCCCTCTTATCATTGATAAAAACGAGCACTTCACAGTCTATAGGGATCCTGCTCTTATTGGATCAGA

AACAGGAGCTAATCACATTTCACCTTTTTTGAGCCAGCATCCTTTTTCTCTTCATTCCTCATCCCATAGAACCTGTTTAAACCCAGGTACCCATCACCCT

GCCTTAACGCCAGGACCCCACTTACTAGCTGGGTCAACTAGTCAAACTCCATTACCTACCATTAACACTCACCCTCTCACTAGTGGTCCACACCATCCTG

TCCATCACCCTCATTTGCTTCCCACTGTGTTACCTGGAGTGCCTACTGCCTCTTTACTCGGTGGCCACCCACGTCTAGAGAGTGCTCATGCAAGCAGCTT

GAGCCATTTAGCACTAGCACACCAGCAGCAGCAACAGTTGTTACAGCACCAGTCACCTCATCTTCTTGGACAAGCCCATCCTTCCGCTTCATATAATCAG

CTTGGACTTTATCCAATTATTTGGCAATATCCGAATGGAACACATGCATACTCAGGACTTGGTCTCCCTTCTTCTAAGTGGGTTCACCCAGAAAATGCAG

TTAATGCTGAAGCTTCATTAAGGAGG AATTCTCCCAGTCCTTGGCTACATCAACCCACTCCTGTGACCTCAGCGGATGGTATTGGATTACTTAGTCACA

TTCCTGTCAGACCTTCCAGTGCAGAGCCTCATCGACCTCACAAGATTACAGTGCATTCCAGTCCCCCACTGACAAAGACATTAGCAGATCACCACAAAGA

 - UNI7078 - AGAATTGGAGAGGAAAGCTTTTATGGAACCATTACGGTCTAATGCATCCACATCAGTAAAAGGTGACCTGGATCTTAATAGGTCACA

GGCAGGAAAAGATTGTCACTTGCATAGGCATTTTGTGGGTCCAAGGCCACCCCAGGAGACTGGAGAGAGACTGAACAAATACAAGGAGGAACATCGTCGG

ATTCTTCAGGAGAGTATTGATGTGGCTCCATTTACAACCAAAATCAAGGGTCATGAGGTTGAAAGAGAGAATTACTCCAGAGTAGTACCATCATCTTCTA

GTCCTAAAAGCCATGCTATCAAACAAGATAAAGACGTAGACCGCTCCGTGTCAGAGATTTATAAGATGAAGCACTCAGTGCCTCAGAGTTTGCCCCAGAG

TAACTACTTCACTACTTTATCTAATAGTGTGGTCAATGAGCCACCAAGATCCTACCCATCCAAAGAAGTTTCCAACATTTACACTGAGAAACAAAATAAT

AACCTTTCTGCAACAGCCAATCCTCAAACTCATTCTTTTATATCATCTCTTTCGAAGCCTCCACCTTTGATTAAACACCAACCAGAAAGTGAAAGTTTAG

TGGGCAAGATACCAGACCATCTTCCCCATCAGAGTGCATCTCACTCAGTAACAACGTTCAGAAGTGATTGTCGGAGCCCTACCCATCTGACTGTTTCTTC

TACTAATGCACTCCGCAGCATGCCTGCTCTGCACAGGGCACCAGTATTCCATCCACCAATCCACCACAGTTTGGAAAGAAAGGAAAGCAGCTACAGTAGC

CTTTCCCCTCCAACACTGACACCGGTGATGCCAGTAAATGCTGGTGGCAAAGTTCAAGAATCTCAGAAGCCTCCAACTCTAATTCCTGAGCCAAAAGACT

CTCAGTCAAATTTTAAGAATTCTTCTGATCAGAGTCTAACGGAAATGTGGAGATCTAATAACAACCTCAACAGAGAGAAAGCTGAGTGGCCCGTGGAAAA

GAGTAGTGGAAAGTCCCAGGCTGCTGTGGCATCTGTCATTGTTCGTCCACCTTCTAGTACAAAAGTTGATAGTGTGCCATCTGTACCATTAGCTTCCAAA

GATCGAGTTTGTGAAAGATCTTCATCTGGGGCAAATAAAACAGATTACCTCAAACCAGAAGCCGGAGAGACTGGAAGAATTATTCTACCAAATGTGAATT

TAGAAAGTGCTCATGTGAAATCTGAAAAAAACTTTGAAGCTGTCTCCCAGGGCAACGTTCCTGTTTCAGTCATGTCTGCTGTAAATGTAGTCTCTACTAC

CAAAGCAGATGTGTTCACATCTGCTGCCACTACCACCAGTGTCTCCAGCTTGAGTAGTGCAGAAACAAGTTATTCTTTATCAAATACCATTTCGGCCTCT

ACACCCTTCGAATGTACTTCTTCAAAAAGTGTTGTTAGTCAGGCAGTGGCGCAAGCAAAGGACTGCACAGTCAGCACCGCGGTTCCAGGCACTCTGGCCT

GTAGTAAGACAGGAAGTGCTGTTCAGCCCGGCTCTGGCTTCTCAGGCACAACTGATTTTATTCATTTAAAAAAGCACAAGGCAGCGTTGGCTGCAGCTCA

GTTTAAAAATAGTAGTGTCAGTGAGGCTGAACTTAATACTGTGAGAAATCAGACAGTGGCAGCCTCTCTTCCCCTGGATAGCACCATGACCTGCACTGCA

AGTAACAAAGCAATCTCTGTAGGAAATGGGCCAGCAGCCCAGTCCAGTCAGCCCAACTACCACACTAAACTGAAGAAGGCCTGGCTCACCAGACATTCAG

AAGAAGATAAAAATACTAATAAAATGGAAAATTCAGGGAATTCTGTATCCGAAATTATTAAGCCATGTTCTGTCAACTTAATAGCCTCTACATCTAATGA

TATAGAAAATCGTGCAGATGGCAGAGTCGCTGTAGATAAATATGGAAGAGATGAGAAAGTCAGCAGGAGAAAAGCCAAAAGAACTTACGAATCTGGCTCT

GAAAGTGGAGACTCAGATGAGAGCGAAAGCAAGTCGGAGCAGAGGACTAAACGGCAGCCGAAGCCAACTTATAAAAAGAAGCAGAACGACCTGCAGAAGA

GGAAAGGCGAGGTCGAAGAGGACTCGAAGCCTAATGGAGTTCTCAGCAGGAGCGCCAAGGACAAAAGTAAACTGAAGTTGCAGAACAGTAATAGCG CTG

GCGTTCCTCGTTCCGTGCTGAAAGACTGGCGGAAGGTCAAGAAGCTGAAGCAAACTGGAGAATCATTTCTGCAGGATGACTCCTGCTGTGAGATAGGTCC

CAACTTACAGAAGTGCCGAGAGTGCAGACTTATCCGGAGTAAGAAGGGGGAAGAATCAACTCACTCACCGGTGTTTTGTAGATTTTACTACTTTAGGAG 

ATTGTCCTTTAGTAAGAATGGAGTAGTCAGAATAGATGGTTTCTCTTCTCCTGATCAATACGATGATGAAGCCATGAGTTTATGGACCCATGAAAATTAT

GAAGATGATGAAGTAGATGTTGAAACCTCTAAGTATATCTTGGACATAATAGGTGATAAGTTCTGTCAGTTAGTAACGTCTGAGAAAACAGCGTTGTCCT

GGGTGAAAAAGGATG CCAAAATTGCATGGAAAAGGGCAGTTCGAGGTGTCCGGGAGATGTGTGATGCGTGCGAGGCCACACTGTTCAACGTCCACTGGG

TTTGCCGCAAGTGTGGATTTGTGGCTTGCTTGGACTGTTACAAGGCCAAGGAAAGGAAGAGTTCTAGAG ATAAAGAGCTGTATGCTTGGATGAAGTGTG

TGAAAGGCCAGCCCCATGACCATAAGCATCTGATGCTGACTCAGATTATCCCTGGCTCTG TGTTGACAGACCTTCTTGATGCCATGCACATTCTTAGGG

AAAAATATGGTATTAAATCCCATTGTCACTGTACAAACAGACAGAATTTACAAGGTGGAAATGTTCCTACAATGAATGGTGTGTCTCAA GTTCTACAGA

ATGTTCTTCACCACAGTAATAAGACTTCTGTGTCCCTGCCTGAGTCTCAGCAGCAGAACAGCCCTCAGAAATCTCAGACTAACGGCAACAGTAGCCCTGG

AAGTGCAAGTACAGACAGCAGGTTGACACCTCCAGAGTCCCAGTCACCGCTGCACTGGCTAGCTGATCTTGCTGAGCAGAAATCCAGAGAGGAAAAACAA

G AAAACAAAGAATTTACTCTTGAAAGGGAAATCAAAGAAGATGGAGACCAAGATGCCTCTGATTCTCCAAATGGCAGCACATCACCTCCAGCATCCCAG

AGCAACGAACAGGGTTCAACCCTACGTGATTTGCTGACCACAACAGCTGGCAAGCTTCGTGTGGGCTCTACAGATGCTGGCATTGCCTTTGCGCCAGTAT

ATTCAATGGGAACCTCA AGTGGCAAAGGTGGCCGGACTATGCCTAACATTCTTGATGACATCATTGCTTCAGTTGTTGAAAACAAAATTCCACCAAATA

AAACCTCCAAGATCAATATAAAATCAGAACCTAATGAAGAACCCAAAGAAAGCAGTCTGCCTGCCACGGATGAAAGCAATAAGTCTTATCGTGACATACC

ACATTCTTGGATCTGTGACCAGCATATTTTATGGCTTAAAGATTACAAGAATAGTAATAACTGGAAGCTTTTCAAAGAGTGCTGGAAACAAGGACAG CC

TGCAGTGGTTTCCGGTGTGCATAAGAAAATGAACATTAGCTTGTGGAAGGCAGAATCAATTAGTCTGGATTTTGGAGACCACCAAGCTGATCTCCTCAAC

TGCAAAGACAGCATTGTTTCCAATGCCAACGTTAAGGAGTTCTGGGATGGTTTTGAAGAAGTGTCAA AACGTCAAAAAAACAAAGGTGGAGAAACAGTA

GTATTAAAGTTGAAAGACTGCCCATCTGGGGAGGACTTCAAGGCCATGATGCCAACAAG ATATGAAGACTTTTTAAGATGTCTGCCATTACCAGAATAT

TGCAACCCAGAAGGGAAGTTCAATTTGGCCTCCCATTTGCCAGGGTTCTTTGTACGCCCTGATCTAGGACCCAGGCTGTGCAGTGCCTATG GTGTTGCT

GCTGCTAAGGATCATGATATAGGAACCACAAATCTTCACATTGAAGCTTCTGATGTTGTCAATGTCCTAGTCTATGTCGGCATAGCAAAAGGAAATGGCG

TCCTCTCAAAAGCAG - UNI6410 - GAATACTTAAGAAATTTGAAGAAGAAGAATTAGATGATGTTTTAAGAAAAAGATTAAAGGATTCGAGTGAAA

TCCCTGGTGCTCTATGGCATATTTATGCTGGAAAAGATGTTGACAAGATAAGGGAATTTCTTCAAAAG ATTTCAAAAGAACAAGGCCTTGAAGTTCTGC

CAGAGCATGATCCAATCCGGGACCAAAGCTGGTATGTGAATAGAAAGCTCCGCCAGAGACTGCTTGAGGAATATGGGGTGAGAGCCTGCACTCTGATTCA

GTTCCTTGGTGATGCCATTGTTTTGCCAGCAGGAACACTTCACCAG GTACAAAATTTTCACAGCTGTGTTCAGGTGACCGAAGACTTTGTCTCTCCAGA

ACATCTTGTACAGTCGTTTCACTTAACACAGGAGCTGAGGCTTTTGAAGGAAGAAATCAATTACGATGATAAACTCCAG GTTAAGAATATCTTGTATCA

TGCAGTCAAGGAAATGGTGAGAGCTCTGAAGATGCATGAAGATGAAGTAGAGGATATGGAAGACACCTAATTGCGGTTGGAACTGGGATGCCCCTTGAGT

GACGCTAGGTCTGACTTAAGCTCCATTAAACCATCAGTGCCAAGAAATTCTCTTTGTAGTAATTACTTGCTACTGACACCATACCAGTATAGCATTATGC

CACAGCCCCTGTGATTCAATGCTAGCTATAAACCAAGCTAAATTTAAAAGCAGTACTATATAGCTGTTCCTGTATCATAGTGTATATGATGTTTGTGAAG

ATGCCAGATTTAAAATGATGTATTTATTTTTGGTAAAAAAAAAAATCTATGCTATATTGTTGATCAAGTGTAAATGTGCTGTTGTACAGTTTAATAAAAT

AACTGATATTTTTCACTACATTGAGACAGTTACTGTGAGACTAGGACACACCAGCTGTTGCCTGCGTTTGGGAAATTGCTGGATTGCACAGCAGTCACGT

CATAATCAGAAAATTACTGCCAAATAATTGTAAAATGTGTAAAATACAAAGTACATAAAGTAGATACTAAACTCAGACACTTCAATATTTTGTTGAAGCT

ATTGACTGTACAATTAAACGTTTTCAAAAGGTGTAATTTATTTAAAATTGTCTCATTTTGGTAAAATTTATGTGAAGTTTTAAAGCTAAATATTAAACTT

AATATGCTATGTAAATATATACATATATACATTTAAGGATGTATTTTTTTAAAACATTGGCTTGCTTTTGTTAAAGTGCAAGTGTTACATATGGCTTTGT

ACATTACAGTTGAAAGGGGTTTTACATTTTCCATTAAAAGACTTTATCAAG
Translation
 - UNI14486 -  - UNI569 - MQG GPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQ VLEPQNVDPSMVQMTFLDDVVHSLLKG

ENIGITSRRRSRASQNISTVH GHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGE ENPKGKNKHVVT

KRRKPEEAEKRLSMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEYEPKNKVTSKVNGEEGQSQAAEEAGEETLIDTRPPWDQMQEDKNHNEGEKP

KSTDSHLQDKMTLRSSEQATVADHNSNDSVLQECNVENQRTVELLPKDRLVSRTPTPKCVTDIKNDTHSERAAQENLNTFGLQTPENMDPNVSDSKHSNA

KYLETAKQDCDQSWVSDVVKVDLTQSSVTNAPSGSDKRDTEKERNHYVSYMSSLSAVSVTEDQLHKRSPPPETIKAKLTTSVDTQKAKSSSSPEVVKPKI

THSPDSVKSKAAYGNSQAVGERRLANKIEHELSRGSFHPVPTRGSALETTKSPLIIDKNEHFTVYRDPALIGSETGANHISPFLSQHPFSLHSSSHRTCL

NPGTHHPALTPGPHLLAGSTSQTPLPTINTHPLTSGPHHPVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQSPHLLGQAH

PSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRR NSPSPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTK

TLADHHKE - UNI7078 - EELERKAFMEPLRSNASTSVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQESIDVAPFTTKIK

GHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISS

LSKPPPLIKHQPESESLVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVFHPPIHHSLERKESSYSSLSPPTLTPVMPVNAGG

KVQESQKPPTLIPEPKDSQSNFKNSSDQSLTEMWRSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRVCERSSSGANKTDY

LKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNVVSTTKADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAV

AQAKDCTVSTAVPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVRNQTVAASLPLDSTMTCTASNKAISVGNGPAAQSS

QPNYHTKLKKAWLTRHSEEDKNTNKMENSGNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGSESGDSDESESKSEQRT

KRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLKLQNSNSA AGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSK

KGEESTHSPVFCRFYYFRR RLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSKYILDIIGDKFCQLVTSEKTALSWVKKDA AKIAWK

RAVRGVREMCDACEATLFNVHWVCRKCGFVACLDCYKAKERKSSRD DKELYAWMKCVKGQPHDHKHLMLTQIIPGSV VLTDLLDAMHILREKYGIKSH

CHCTNRQNLQGGNVPTMNGVSQ VLQNVLHHSNKTSVSLPESQQQNSPQKSQTNGNSSPGSASTDSRLTPPESQSPLHWLADLAEQKSREEKQE ENKEF

TLEREIKEDGDQDASDSPNGSTSPPASQSNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGTS SGKGGRTMPNILDDIIASVVENKIPPNKTSKI

NIKSEPNEEPKESSLPATDESNKSYRDIPHSWICDQHILWLKDYKNSNNWKLFKECWKQGQ PAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDS

IVSNANVKEFWDGFEEVSK KRQKNKGGETVVLKLKDCPSGEDFKAMMPTR RYEDFLRCLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYG GV

AAAKDHDIGTTNLHIEASDVVNVLVYVGIAKGNGVLSKAG - UNI6410 - GILKKFEEEELDDVLRKRLKDSSEIPGALWHIYAGKDVDKIREFLQK

 ISKEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQFLGDAIVLPAGTLHQ VQNFHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINY

DDKLQ VKNILYHAVKEMVRALKMHEDEVEDMEDT

For any suggestions or comments, please send an email to unitrap@crg.es