Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037885 (Stk35)
Chromosomal location
Chr 2: 129626297 - 129658023 (+)
Description
serine/threonine kinase 35 Gene [Source:MGI (curated);Acc:Stk35-001]
RefSeq_dna
NM_001038635 NM_183262 
RefSeq_peptide
NP_001033724.1 NP_899085.2 
UniGene
Mm.397985 
MGI
MGI:1914583 
Uniprot/SWISSPROT
Q80ZW0 
Uniprot/SPTREMBL
A2ANF2 
Human Ortholog
ENSG00000125834 (STK35)
Omim not available
UniTrap UNI33119
Vector Insertion
Chr 2: 129626583 - 129627139
Public Clones IST14023D11 (tigm) IST14926B6 (tigm) IST14560B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17078
Vector Insertion
Chr 2: 129636974 - 129653509
Public Clones CMHD-GT_382E11-3 (cmhd)
Private Clones OST449707 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099380
Sequence
GCTGACCAGAGCGGCGGCGGGAGGTGCAGCTTACATAAAGAGGTTACGTAAAGTGCTCAGCTGGCGTGAACTCGGGGACGGCCACGGGAACCTGGAAGCC

GAGGCCTCCCCCGGGAGCGTTGCTGTCATCACAAGAGCAGCGCCGCGACGCGCTACACGCTCAGCCAGGCTCCCCGCCTCGCGCCCTACCCGGCTCTGCA

GACAAGCCCGGCTCGGAACGGACCATCCTCCGGCGCGGGCTCCAAGGGGGAACCGGTTCGCCCGGAAGAGGAACAGCGCCGGCCAG - UNI33119 - 

ATCACCATCCAAGGTCCCGCTCCTCCACATCTCGGGGCTAGACGGAGGGATGAGGCAAGGGGGGCCCGGGCGGCGCCGTTGCTGCTCCCCCCGCCCCCCG

CAGCCATGGAAACGGGGAAAGAGAACGGAGCCCGCAGAGGGACAAAAAGCCCGGAGCGGAAAAGGCGAAGCCCAGTCCAGCGGGTACTGTGCGAGAAGCT

GAGGCCGGCGGCCCAGGCCATGGATCCGGCTGGGGCCGAGGTCCCGGGCGAGGCCTTCCTGGCCCGGCGGCGGCCGGATGGCGGCGGCGGGGATGTTCCT

GCACGGCCGCGCTACAGCCTCTTGGCGGAGATCGGGCGCGGCAGCTACGGCGTGGTTTATGAGGCTGTGGCTGGGCGCAGTGGGGCCAGGGTGGCAGTCA

AGAAGATCCGCTGCGACGCTCCCGAGAACGTGGAGTTGGCACTAGCAGAATTCTGGGCCCTCACCAGTCTCAAGCGGCGGCACCAGAATATCGTGCAGTT

TGAGGAGTGCGTCCTACAGCGCAACGGGTTAGCCCAGCGCATGAGTCACGGCAACAAGAACTCACAGCTTTACCTGCGCCTGGTGGAGACCTCGCTCAAA

G - UNI17078 - GTCGATCCTTCGGGACCCACAGTCTCATCGTGTCTCGGACAGGATGGCAGAGGGTACAGGTGGTGGTGATCTCCTGACAGCTGGA

CCTCCCACAATGTGAAGCTCACGCTTGGGCTGCCCACTCTACCCTTCTCTTTCTCCTTCAGTAGAATAATAATTGTTTTTCTAAACATTAAACCATCAAG

ACTTCTGAAGAGCAGAAGGCTACACTCTGGACAGGCACCTTTTTATTGTTTTTGTTTTGTTTTGTTTTGTTTTTTTTAAGAACATTGAATGTGGACAAAG

CTTATGCATATAGTCACTGTTAATCTGTTGAGTTCTTAAGTTAGGAAGCAGTTTTGGTTTTCTCTTTCACGTTCTGTTTTCTTTCTTTACACACATCTCA

GTTCTGCTTTAGCACCCCACTTCCCACAGAATTCTGTCTCCCCAGAGTTTGGTATTTCTCCTGGAAAGGGATGCGAACAAAGAGCTAAGGAAGCAGCCTC

TGAGTTGCCTCCCCCAGATGTGGGAGCTGCTGACTCCTGGGAAGGGCTGGTTGGTCCTGGCCTCAGACAGGATCAGAGATGAAGAACCTCTCAGAAGAGG

AACACCAGGGGTTGGCCCGAGGGACTCTAGAAAGAAGACCTAAACCATGGGTTTGGTTCTCGTTAAGTTCTTGAGAGCCCCAGGCCACACCAGGACTCCC

TGTAGTGGGCATTGCTTCCCTCTTTTGCCCTGAGTCCCTGAGGAAAGAAACCAAGAGTGGTCATCCCATCACTTGGGGATTGAGACTCCATCCCCACTCT

TTGCACAAGCCTATCTTCTATTAGGACTGTTGTGCCAACCCCCTGTCAAACTTGGTCTTCCTTGGCCTCTTGTCACTACTATGAGACCAGTACCTTTCAT

CCTCTCCTGGATTGTCTTCTCTGTGTGCTACAAGTCCAGCCTGTCACAGACACTACCTAGGTCTCAAGATCCAGTTTTGATCCTTGCAGAGTACCCTTAA

CTGGCTGCTGACATCATTTCCTCACAGTGAAAGGTGTGCCCTGTGTACCAGGATCCCTAGTGTCACCACTGGGTGACACTGTCAAGCGCCATCTCTCTTA

CCCCCAGGGACTTCATGTTAGGTGATCAACCTCCATGTCACTGTTGTCTGATAAGCAGAGAAAGGACCTGCCTTGAAGAGGGAGGTCTGAGGCAGATGGG

AGTGTCCAGGTGGCTAATAGAGGCCCATGTAGCAGCTAGCCATATAAAGCACTGCGACACACATTTTGACTTGTACCTCCTTGCAGTGTTCTGACAGCCT

CCTGAGGGAAGATCTCCTCCCTCCAGCTGCCTCATGGACCCACCATTCTCTCTGGTGTTGCCCTCTACTTAGACGCACCTTTGGTTGCTCCAAAACTTTT

CCAGACTTTTCACCTTGTTCTGGCCTTGTGGGATGGGGTCTCTGGACAAGGAAAGAAGGTATCTGTGTTCATTCTTGTTTATACTTCCTAAACTAGCACA

GGGTGGATAGAGATATAAGAGGTCAGGGGGAGCTTTCCCTCAAGCAGGGGTCCCTTGTTCCTGCAGCGTGGGGGAAGGCCAGCACAGCTGACCCTGACAG

CTGGCCCCGCTTAGCAGCGCTGTCCACGTTTCTCTTTCCAGCCTTCTGGTAGGCAACTCAGCACCAAAGTTTCTTTCTCCTCTTGGCCAGAGGTCAGCTG

CTGTTCCTGTGGGTACATGACTGCAGGTGGGAGCCCTACCTTGTGCTGCACTGTGATAGCATCTCGTCTCCTTGAGTGACTTTATAAGCAGCCTCCTGAG

CCTAATCAGAGTGGCCCCTGGGAGAGTGGGAACAGCGGCGTCCCCTAAGTGCAAGATACATTCCATTTCTGTTCTGCTGCCCTCCCTCCCCTTGGGTGCT

GCAATCTCTTTGTGCCTGAGCAGATGGGAAAAGCAGTCTCTGAGCTCAGGACCCCGACTCTTCCTGCTCTAGTCCTGCTCTGGGTTCCTGATAAAGGCTC

ACTATCTACCTTATTCTTTTCTTTCCCGTCTCTAACAAGGCCTGGGTTATAGTGCTTTCCCACCGTACTTTTCTTGGTGTCAGTGTAGCCTCTGCAGTTT

GCAGGTGGGTAGCCTAGTGAGGGGTAGCCTGCTTCCCTGCACCTTCTCTTCCATGAATCCCAGCTGCTTCTGGCCTGGAGATTGCACCTCTTTCTCTGGC

TCCAGTGAGAGCCATGTCTTGAGCCCCAAGTGCCTCCTCCTGCTGTTTTCATTCTTCCCTCCCTGTAGTCCCTGCTATCTATCACCTGCCAGCCAGCTGC

AGGCTGGCCCCAGGACATGCTTGCTGTGCTGTGGCTGGTGGGTCAGGACCCCTGTGGGCTCTGCAGTCTTCTCAGAGTCCAGCTCCCTGTCCCTCTTGGA

GATGGACATCCTTTTCCTCTGTTACTTCCCTCTTCTGCCTCTGTCTGGGGTGCAGACTTGCCAGTAGAAGCTCTGGGGCATCTGATCTTGGGTGCCTCCA

GGTTTGTTAAATCTGTTCACATTCTAGAAGTTTGCAGAACTCTTAACGTTTGTCCTTTTGGGGGTGGTGGTGAGGATTGCCTGTTGGGAGACTAGCCTGG

CCTCAGTTCTCAGTTCTGAGCGCAGGATAGATAGATCATAGTGCCTTACTTATTCCATTGTCTTCCCCTGTCCAGACTCAGCCAGAAGCAGGTGGCTGTC

TTCTGGCTCATTTTGTCACTTATACTCACAGTCTCCCACCTGTATATAGCCACAGGAGAAGGAAACCTGAGCCCCCAGCCACCTCCTGTGGGCTATAGCC

AGACACACACCCCTCTCGCCTGCCTCCGTGGCCCTCACAGCAGCTTTAGACCAGGACCAAATGCTGCTGCCCACATATGCACACTGCCTTTGTTCCTCCC

TGTTCTTAGCTCTAGCCAGGACGACACTGACTGCACCATCCAAACTGGCACCAGCTAACCCCCTCTGGTCACTGGAGACCAAGGTTCGGGCTCTAGCCTC

ACCTAGCTTATGGGGCACTGGGGCAGGGAGTAAGAACTCCAGTCCCACCTTGTAGGGTTTGCCCTTTGGCTGCCTGAGGGATGTTTTAATGTTTACTTAA

AGAAAATACCCTGTTTACAGCTGGAGGAGAAACACGCTCACACTAGGTGAAGGTCTGACTCTGGATAGGGCCTGGCCTCCTTTGTGGCACTGCCAGTAGT

AACTGCAGTGGTGGTGAAGGCGGAGAAGCCCGGAGGGAGCAGAGGCTCTTGACTCACTCCTCTTCCTAACCCTGTGGTGCTGAGACCACTCCCTGTTTTC

CTCATAGCCTTTTTGCCTCACTAATCCCCATGGTGTCATTTCCTTCCTCCAAGATTCTCAGCTCTAACATATCACTATTTTAGAAAACCAGTGTTTTGCA

GCAATAAAGTTATATTGTTTTGTGTGAATCTTATTCCAAGAAGAGGAAAAGAGCATTGTGGGAATCTGTTGATGCTATTAGCTGTTTACTGTTTGAGAAG

ATAGCTCGGAGGGATGGATGAATATGGCTTTTAACCTTTAGGTATCTTGAAGAGTGGGAAGAGCAAGAGTTTGACTGCTGTCCTCCCAGGAGGGACTGTA

CGGCCCTCGCCTTACTCTGATGTGCCCCTTCCTGCCCTGCCCTGCCCACCAGGAGCTCTTCCATCTCTCTTCCTCCCACCCCATCTGGGGGCACTGGGGG

GGCTCAACTCTAGGCAGGTCTTTGGGTTACCCCTCCCTGTGACTGGATCTCTCTCCCTACAAGACAGCTGCTGGGAGTCTACCTCCGAATTGGCTGAGAT

TGCTGCTTCGGCCCTCCAGGCCAGCAGACTCTGGAGGCTGAGGCTTCTGCCTTCTCTGATTCCGAGCTCATGCACACAGGTCAGCACAGGCCTGACTTTG

AGGGAAAGGAGCCTTGTCTGGACACATGCTCTGGAAGGAGAACCCAGTAGGTACTGGCATCTTGGCTGATGTCGGTATCCACAGCCATTACTGAGGGCCA

AGTCTGCTACCATTCATTGCCTAGGGCCCCTAGTATTGGGGAGAGTGCCAGAACAAGTGGGCCTTCCCCCCCCCCCCCGCCTTTTAAAATCCAGATGAGA

TCATAGGAAAAAGGAAACCTATTTAGGGGACTTCCCCCCCCCCCCCCCAACACTTTTACCCCAAGGGCTCCTTGCCGTCAAAACTGGAGGATATTTCAGT

TACTCTTAATGCTCATGTGGGTCAAACTTGGTTTTGAAAGAGGTTTAAAGCCAGGCACAAGGTTAGTTTCAAATACTAGTTAATCCAATTTTTTTCCTTT

TTTTTTTTTTTTTTGCACAGAAGCTGGTAATATAGGACCTATGTGTGAACTTTATATGAATATTTTTTTGTACTTGGCTTACTTGGGTTGTTATGATAAC

ATATTTAAGTTCCTTGAACACTGTGGATTCCCCCTAATGTGTATGAATGACTGAAACGTTGTAAATTAAGGGACGTTTGTGTGAATAAAGTTATTTGATG

GGGTCAAAAAGCCATACGCTATTTGAAAA
Translation
 - UNI33119 - METGKENGARRGTKSPERKRRSPVQRVLCEKLRPAAQAMDPAGAEVPGEAFLARRRPDGGGGDVPARPRYSLLAEIGRGSYGVVYE

AVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNIVQFEECVLQRNGLAQRMSHGNKNSQLYLRLVETSLKG - UNI17078 - GRSFGT

HSLIVSRTGWQRVQVVVIS
Transcript ENSMUST00000082067
Sequence
GGCTCTGCAGACAAGCCCGGCTCGGAACGGACCATCCTCCGGCGCGGGCTCCAAGGGGGAACCGGTTCGCCCGGAAGAGGAACAGCGCCGGCCAG - UN

I33119 - ATCACCATCCAAGGTCCCGCTCCTCCACATCTCGGGGCTAGACGGAGGGATGAGGCAAGGGGGGCCCGGGCGGCGCCGTTGCTGCTCCCCC

CGCCCCCCGCAGCCATGGAAACGGGGAAAGAGAACGGAGCCCGCAGAGGGACAAAAAGCCCGGAGCGGAAAAGGCGAAGCCCAGTCCAGCGGGTACTGTG

CGAGAAGCTGAGGCCGGCGGCCCAGGCCATGGATCCGGCTGGGGCCGAGGTCCCGGGCGAGGCCTTCCTGGCCCGGCGGCGGCCGGATGGCGGCGGCGGG

GATGTTCCTGCACGGCCGCGCTACAGCCTCTTGGCGGAGATCGGGCGCGGCAGCTACGGCGTGGTTTATGAGGCTGTGGCTGGGCGCAGTGGGGCCAGGG

TGGCAGTCAAGAAGATCCGCTGCGACGCTCCCGAGAACGTGGAGTTGGCACTAGCAGAATTCTGGGCCCTCACCAGTCTCAAGCGGCGGCACCAGAATAT

CGTGCAGTTTGAGGAGTGCGTCCTACAGCGCAACGGGTTAGCCCAGCGCATGAGTCACGGCAACAAGAACTCACAGCTTTACCTGCGCCTGGTGGAGACC

TCGCTCAAAG GAGAAAGGATCCTGGGCTATGCTGAGGAGCCCTGCTATCTCTGGTTTGTCATGGAGTACTGTGAAGGTGGAGACCTCAATCAGTATGTC

CTGTCCCGGAGACCTGACCCAGCCACCAACAAAAGTTTCATGCTACAGCTTACAAGCGCCATTGCCTTCCTGCATAAAAACCACATCGTGCACAGGGACC

TAAAGCCAGACAACATCCTGATCACAGAGCGGTCTGGCACCCCCATCCTCAAGGTGGCAGACTTTGGACTGAGCAAGGTCTGTGCAGGGCTGGCACCCCG

AGGCAAAGAGGGCAATCAAGATAACAAAAATGTGAATGTGAATAAATACTGGCTGTCCTCAGCTTGTGGCTCAGACTTCTACATGGCTCCCGAAGTCTGG

GAGGGACACTATACAGCCAAGGCGGACATCTTTGCTCTGGGCATTATCATCTGGGCAATGATAGAAAGAATTACCTTTATTGACTCTGAAACCAAGAAGG

AGCTCCTGGGGACCTACATTAAGCAAGGGACTGAGATCGTCCCTGTTGGTGAGGCGCTGCTAGAAAACCCAAAGATGGAGTTGCATATCCCCCAGAAACG

TAGGACTTCCATGTCTGAGGGGGTCAAGCAGCTCTTGAAAGACATGTTAGCTGCTAACCCACAGGACCGACCTGATGCTTTTGAACTTGAAACCCGAATG

GACCAGGTCACATGTGCTGCTTAAACTCCAGGGCTGAACGTCTTGGGTGTTTTTAAACTAG - UNI17078 - GTCGATCCTTCGGGACCCACAGTCT

CATCGTGTCTCGGACAGGATGGCAGAGGGTACAGGTGGTGGTGATCTCCTGACAGCTGGACCTCCCACAATGTGAAGCTCACGCTTGGGCTGCCCACTCT

ACCCTTCTCTTTCTCCTTCAGTAGAATAATAATTGTTTTTCTAAACATTAAACCATCAAGACTTCTGAAGAGCAGAAGGCTACACTCTG
Translation
 - UNI33119 - METGKENGARRGTKSPERKRRSPVQRVLCEKLRPAAQAMDPAGAEVPGEAFLARRRPDGGGGDVPARPRYSLLAEIGRGSYGVVYE

AVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNIVQFEECVLQRNGLAQRMSHGNKNSQLYLRLVETSLKG GERILGYAEEPCYLWFVME

YCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAFLHKNHIVHRDLKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSAC

GSDFYMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHIPQKRRTSMSEGVKQLLKDMLAANPQD

RPDAFELETRMDQVTCAA - UNI17078 - 

For any suggestions or comments, please send an email to unitrap@crg.es