Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037921 (Ddx60)
Chromosomal location
Chr 8: 64406886 - 64516492 (+)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 Gene [Source:MGI Symbol;Acc:MGI:2384570]
RefSeq_peptide
NP_001074684.1 
UniGene
Mm.275233 
MGI
MGI:2384570 
Uniprot/SPTREMBL
Q811K8 Q8CB98 Q91VI2 
Human Ortholog
ENSG00000137628 (DDX60)
Omim not available
UniTrap UNI28882
Vector Insertion
Chr 8: 64442539 - 64448249
Public Clones not available
Private Clones OST17267 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000070631
Sequence
TTATAAAAGGCGGCCTGAGAGACTCACAAGTTGCCACTTTTTGGAGCTAGCGATTGGTCTTAGGTCTCCTGTGGTCGACTGTGTGCTTGCTTGTTACCTG

CAGCGCGGACCAGCGCGCTCAATACCTGCTGCGCAGACCAGCGGTTCTCTGCACGTAGCAGGTCCAGGTTCCCGGTCTGGGCTTCCCG ATACGACATTT

CATTAATAAGGACCATTGAGAGGAAACAGAGTAAAGGATATTTACATTTTTAATATTTTCCAGTTCAGGTTGAAAGCACAGATAGCAGCAAGAATGG AA

AAAAAATACACAGGTTTTTTAAAAATAATGTCACATTTAATCTTGGAAACTATGTCAAAGGCTGA CTACTCCAGCTTATTCAATGATTTTGTTGAATCT

GAGTTCTTTCTGATTGATGGCGACTCCTTGCTCATCACGTGTGCGTGTGAGAGGTCACTTAAGCCAGGACAGAGTCTCCACTTCTTCTACCTGGTTGAGC

GCTACCTGTTGGATGTTATTAGCAAAGGAGGGCAATTTGCCATAGTTTTCTTCAAG GATGCTGAGTATGCATACTTCAATGTCCCCGAACTTCTGACAC

TGAGAACTGCTTTAATTCTGCATCTTCAGAAGAATACCACTGTTGAAGTTTGGACTAAGTTTTCTAACTGCTTGTCAGAAGAGTGGAATATTTGCTTGGG

TCAGAGTTGCCCATATTTCTTGATACTGGCTGATGAAGGCCTGAACGACCTGCAGACACATCTTTTCAACTTTGTAGTTATTCAGGCCTGGGCAGCAAAG

GTCAATATTGTGCTCTTCTCAGGACAGACATCTGACATCCTTCGTCTTTATGCATACTTTATGCAAAGCTCTCATGGAATGCAGATGTTCTTCAAGGAG 

AATAAGAGAATGATCATGATTGTTTACAAAAGCCTGATTCAACAGCTGGAAAAATACAGAGATATGGCTTTAGCACATCTGTTCGGAGATTTAAAATTCA

ATGATATGGAAGAGAAG GTATGTGAAACTGTATCTCTGCTGAAACAACTCTGGCCAGAAGGATCTGACATCCGATGTGTCTTTTGTGTCACCTCATGTT

CTCTCTTCTTGGAAATGTATCACTGCTACTTAGAAAGCAGAGAGAAAGGAGCATCTGAGGAGATGTCCAAAGTCAAACAG AAAACAGATAATTGCTTAA

CCCTGAAGGACATGGAAGACTTTTGTAAGCTACATTGCCTCAGTGTGGCTCTTTTGCTCCATGTACCTCTCTCTCAGAGAGCTCGCTCAAGATTCATCAC

TGCTAATTGGATTCAGGACCTCAAGACTGTCCTAAAAATG AAAAAGTGGTGCGAGTATTTTATCCTAAGTAATTTGGATATGTTTGAATCTTGGAGTCT

GAATTTACTTCACCTTTCTGACTTAAGTGATGAGCCTTTGTTGAGGAATATTGCTTTTTACTATGAAAATGAAAATAAAGAAG GCCTGGATTTGAATGT

GGGAGATGCCATCATGAACGAGTATGTACATCTCTGGGACACTGTGTCAAAGTTGGTCAGAAAGTTTGATGTGGGAAAACCAATTCCTTTGAGAACAACA

AAAGTTCATTTTCTTGAAAAGACACCATCACCAATCAAAG AAAGTTCCCAGGAGATGATGCCAAATTTAGGTTTTATTCCAATGTCATGTAATTTAGTT

GATGAATTTACTGGAGACATTTTGAAAGACTTGCCTTTCCTAATGAG TGATGACCCCATTGTTACGTCACTGGTAAAGCATAAGGAATTTGATGAGCTT

GTGCACTGGCACTCCCACAGACCTCTCAGTGATGATTATGACAGGACAAAGGTGAATTCTGGAG ACAGAAGAGACCCCAATCATCTTAAAAGGTTGCAG

AAGTATCATAGTTTTCAACGATTTTATGGGGAGTCATTAGAATCAGTCACTTCAAAGACCATCACAACTCAAGGTCCTAAGCCAAAGAAGGATTGTATTA

AGTCCAAGAGCACAAAGGCACAT - UNI28882 - GAGACCAAGGCTGAAATAATTAAAAGAGAAAATAAGAAGAGGTTAATTGCTGAGGAAGAACAA

AAAGAAGAGCAAAAATGGAATGCCCTGTCATTTTCTATCGAGGAGGAAATGAGAAAGAATGTAGACTCAGGAATGAAGAAACTGGAAGAGTTTTTGAAAT

CATGTAAAAGTCGCTCAGTAAAAGCTCAGGTTGAAAGAGTTGGGTTACAGGCTTGCTTGAAAGCCTGGAAGGAACATTGCCAGGCTGAAG GTGAAACCA

CGAAAGACTTAAGCATAGCTGTCAATATGATGAAGAGGATCCATTCCTTGTTGGACAAACACTCTGAACTTCTGCAAGAAGCAGATCAGAAACTCATAGC

CAGATGTCTTAAGTATTTAGGGTTTTGTGAGCTAGCAGTTTCTTTATATCCAACTCAG GATGCATCAGATGGCATAAAAATGAAGAAAAAGAATAAATA

TTCAGTTGGGATTGGGCCGGCTCGGTTCCAACTACAATATATGGGTCATTATTTAATACGAGAAGAAAGAAAAGACCCAGACCCCAGGGTCCAAGATTTT

ATTCCTGACACATGGCAG CGAGAGCTCCTGGATGTGGTGGATAACTATGAGTCTGCAGTAATTGTTGCCCCAACATCATCTGGCAAGACTTATGCTTCC

TACTATTGCATGGAAAAGGTGCTGAAAGAGAGCGATGAAGGCGTGGTTGTGTATGTTGCACCAACAAAG GCTCTTGTTAATCAAGTGGCAGCAACTGTT

GAATATCGTTATGCCAAAAATATGCCAGCTGGTGAATCTCTTTGTGGTGTTTTTACCAGGGATTATCGCCATGATGCCCTCAACTGTCAG GTGCTTATA

ACTGTTCCTGCCTGCTTTGAAATTCTGCTACTAGCTCCTCATCGCCAAAATTGGGTGAAGAGGATCAGATATGTTATATTTGATGAG GTCCATTGCCTT

GGTGGAGAAATTGGAGCGGAAATCTGGGAGCATCTCCTTGTTATGATCCGATGTCCCTTTTTGGCCCTTTCAGCTACCATTAGCAACCCTCAGCATCTCA

CCGA GTGGCTTCAGTCAGTAAAGCGGTACTGGAAGCAAGTAGACAGTACCATGGAGGAAAGAACTGTTTCCAAAAGAACTGGTACCTCCCGTGGCAGCT

ATTACAAAGATCAAGCGCAAGCCAGACAGTCCTACAAAGTTAGACTTG TGCTCTATGGAGAGAGATACAATGACCTAGAGAAGTATTTGTGTTCCGTGA

GACAGGGCGATGTTTGCTTTGATCATTTTCACCCCTGCGCTGCACTAACCATAGATCAC ATTGAAAAGTATGGATTTCCTTCTGATCTTGCCCTTTCAC

CCCGAGAAAGCATACAGCTGTATGACACTATGTGCCAGGTCTGGAAGAGTTGGCCCCAGGCCCAG AGCCTATGTCCAGAGAACTTCACTCAATTTAAGA

ATAAAATAGTCATTAAGAAGTTGGATGCTAGAAAATATGAAGAGAGCTTAAAGGAAGAATTCACGAATTGGGTTAAAAATGGGAACGAGGAGGAG GCCA

GGATGGTGCTGAAGAAACTGAGCCCTGATTACCATGAGCACTCAGGGAGGATGCTGGATTTCTTTCCATGTCTTGTTGAGAAGCTAAGGAAAATGGAGAA

GTTGCCTGCACTATTCTTTTT ATTTAAGTTAAATATTGTAGAAGAATGTGCTGAAAATGCTTTCGAATTTCTGGAGAAAAAACAGGAAGAAAAAAGACC

TCCCAAAGCTGACAAAGAAGCTCGTACCACGGCTAACAAACTTCGGAAAGTTAAAAAATCTCTGGAGAAACAAAAGACAGT AGATGAAAAGGGCCAGAA

ATCTTCCAGAAGATTGGATGAAAGCGTTATGCATGAAACAGAACACAATTACCTCCTGCAGACTCTGGAGAAGAATCTGGAGATTCCCAAGGACTGCACA

TATGCTAATCAGAAGGCAATAGATGATCAG TTATTGCAGAGGGTGTTTCACCGGGTGAGATTCGAACGTAAAGGTGAAACACTGAAGAGGTTGGCAGAA

AGGGGCATTGGCTACCACCACAGTTCCATGAGTGCCAAAGAAAAGCAGTTGGTCGAAATTCTCTTCAGGAAAGGATTCATCAGG GTGGTGACAGCTACT

GGAACACTCGCTTTGGGAATCAACATGCCCTGTAAATCTGTGGTTTTTGCACAAAACTCAGTCTATCTGGATGCTTTAAATTACAGACAG ATGTCTGGT

CGGGCTGGAAGACGAGGGCAAGACCTGTTGGGTGATGTCTACTTCTTTGATATTCCACTGCCCAAAATAGGAAAACTCATAAAATCCAAAGTTCCTGAAC

TTAGAGGACAGTTTCCCCTCAGTATTTCACTCATCCTAAGACTCATGTTGCTGGCTTCCAAGGCGGATGACCTAGAGGATGGCAAGGCAAAG GCACTGT

CAGTGCTGAAGCATTCATTGTTATCCTTCAAACAACCCCGAGCCATAGACATGTTAAAGCTTTACTTCTTATATTCTTTGCAGTTCCTGGTGAAAGAG G

GACATATAGATCAAGAAGGTAATCCTACAGGGTTTGCTGGCCTTGTCTCCCATTTACATTACCACGAACCTTCTAATCTCGTGTTTGTCAGTTTTCTTGT

AAAAGGCCTTTTCCATAAACTTTGTCAGCCAACAAGGGAAG GCCCAAAACGTTTTTCTGAAGATGTAATGGAAAAGCTGGTTTTGGTATTGGCAAATCT

TTTTGGAAGAAGATATATCCCAGCCAAGTTCTATGAGGTTAACTCCAAGTTTTATCAATCAAAG GTGTTCCTTGATGACCTTCCCGAGGACTTCAGTCA

CGCCCTGCTTGAGTACAATACGCAAGTGACAGAAGACTTCGCTTCCTTTCTGCTAATGGTATCCCGATTGGCTGATATGAAACAGGAGTATCAACTCTCC

TTGTCAAAAATCG AGTTCACAGGTAAAGAATGTGAAGATTCGCCACTTGTGTCTCACTTGATGAACTGCAAGGAAGGAAGGGTGGCGGTTTCACCCTTT

GTTTGTCTGTCTGGAAACTTTGATGTGGATTTGCTTAGTCCAGGAGTTCCAAATCAT GTCATTCTACACACACTTGGTATCAATCACACACAAGCCCCG

GTGCTGTGGCCATACGCATTGGATAGTCAAGGAAGAAAAATTCCACTTAATGCCTATGCACTTGATTTCTATAAGCATGGATCCCTTATTGGATTAGTCC

AGGACAATAG GATACATCCAGGGGAAGCTTATAGCCTGTTGAAAGATTTTAATCTTATCATTAAGTCTATCAG TGTCTCCTTGCGTGAACTGTGTGAA

AATGAAGAAGACAATGTTGTTTTAGCATTTGAACAATTGTCTACGTCTTTTCAAGAGAAGTTTGAATTAGTGTGAAAAGAAAAACTATGTAAACTGCTTA

AACTATCACCATAGAATCATTGTGAATTATATATCTTTACTCTTATGTCTTACTCAAACAATCATACATGATGAGATGGAATGAATAAGCAAATAGAGTT

GCCATCAAACTTCTTGTGGTTGCCTCTAATGTACTTGGTGGTTTCTCAAAAAGTTGACAAAAATGCTTATATTTCTAAATTATTGAGGATTGAAGGAAAA

AAAATACAAGAATATTACATATATACATTTAAAGACAGTTTTTACACTCCATGAGACCCAATCAAATATTGCATTTTACATATTTTCACTGTTAGTATGT

CTAAAACTACTTTTGAAGATAGAAAAAAATGATTTTAGTATCCTGAAAGTGTAATATAATCTATACAATCAACATAAAGGGATTTCACTGCTTAGATAGC

TAGTTAATGAAATAATACCTCTTGATATAATATGAAATGTAAAATATGTATATTTTCATTGAATTTTTGTGATGCTTTTAAAGAAAACATGTAGCTAATA

TTTTTCTTCATTTTAATTGTATATAAATGACTGTTG
Translation
 ME EKKYTGFLKIMSHLILETMSKAD DYSSLFNDFVESEFFLIDGDSLLITCACERSLKPGQSLHFFYLVERYLLDVISKGGQFAIVFFK DAEYAYF

NVPELLTLRTALILHLQKNTTVEVWTKFSNCLSEEWNICLGQSCPYFLILADEGLNDLQTHLFNFVVIQAWAAKVNIVLFSGQTSDILRLYAYFMQSSHG

MQMFFKE NKRMIMIVYKSLIQQLEKYRDMALAHLFGDLKFNDMEEK VCETVSLLKQLWPEGSDIRCVFCVTSCSLFLEMYHCYLESREKGASEEMSKV

KQ KTDNCLTLKDMEDFCKLHCLSVALLLHVPLSQRARSRFITANWIQDLKTVLKM KKWCEYFILSNLDMFESWSLNLLHLSDLSDEPLLRNIAFYYEN

ENKEG GLDLNVGDAIMNEYVHLWDTVSKLVRKFDVGKPIPLRTTKVHFLEKTPSPIKE ESSQEMMPNLGFIPMSCNLVDEFTGDILKDLPFLMS SDD

PIVTSLVKHKEFDELVHWHSHRPLSDDYDRTKVNSGD DRRDPNHLKRLQKYHSFQRFYGESLESVTSKTITTQGPKPKKDCIKSKSTKAH - UNI288

82 - ETKAEIIKRENKKRLIAEEEQKEEQKWNALSFSIEEEMRKNVDSGMKKLEEFLKSCKSRSVKAQVERVGLQACLKAWKEHCQAEG GETTKDLSI

AVNMMKRIHSLLDKHSELLQEADQKLIARCLKYLGFCELAVSLYPTQ DASDGIKMKKKNKYSVGIGPARFQLQYMGHYLIREERKDPDPRVQDFIPDTW

Q RELLDVVDNYESAVIVAPTSSGKTYASYYCMEKVLKESDEGVVVYVAPTK ALVNQVAATVEYRYAKNMPAGESLCGVFTRDYRHDALNCQ VLITVP

ACFEILLLAPHRQNWVKRIRYVIFDE VHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPQHLTE EWLQSVKRYWKQVDSTMEERTVSKRTGTSRGSY

YKDQAQARQSYKVRLV VLYGERYNDLEKYLCSVRQGDVCFDHFHPCAALTIDH IEKYGFPSDLALSPRESIQLYDTMCQVWKSWPQAQ SLCPENFTQ

FKNKIVIKKLDARKYEESLKEEFTNWVKNGNEEE ARMVLKKLSPDYHEHSGRMLDFFPCLVEKLRKMEKLPALFFL LFKLNIVEECAENAFEFLEKKQ

EEKRPPKADKEARTTANKLRKVKKSLEKQKTV VDEKGQKSSRRLDESVMHETEHNYLLQTLEKNLEIPKDCTYANQKAIDDQ LLQRVFHRVRFERKGE

TLKRLAERGIGYHHSSMSAKEKQLVEILFRKGFIR VVTATGTLALGINMPCKSVVFAQNSVYLDALNYRQ MSGRAGRRGQDLLGDVYFFDIPLPKIGK

LIKSKVPELRGQFPLSISLILRLMLLASKADDLEDGKAK ALSVLKHSLLSFKQPRAIDMLKLYFLYSLQFLVKE GHIDQEGNPTGFAGLVSHLHYHEP

SNLVFVSFLVKGLFHKLCQPTREG GPKRFSEDVMEKLVLVLANLFGRRYIPAKFYEVNSKFYQSK VFLDDLPEDFSHALLEYNTQVTEDFASFLLMVS

RLADMKQEYQLSLSKIE EFTGKECEDSPLVSHLMNCKEGRVAVSPFVCLSGNFDVDLLSPGVPNH VILHTLGINHTQAPVLWPYALDSQGRKIPLNAY

ALDFYKHGSLIGLVQDNR RIHPGEAYSLLKDFNLIIKSIS SVSLRELCENEEDNVVLAFEQLSTSFQEKFELV
Transcript ENSMUST00000093485
Sequence
TTATAAAAGGCGGCCTGAGAGACTCACAAGTTGCCACTTTTTGGAGCTAGCGATTGGTCTTAGGTCTCCTGTGGTCGACTGTGTGCTTGCTTGTTACCTG

CAGCGCGGACCAGCGCGCTCAATACCTGCTGCGCAGACCAGCGGTTCTCTGCACGTAGCAGGTCCAGGTTCCCGGTCTGGGCTTCCCG ATACGACATTT

CATTAATAAGGACCATTGAGAGGAAACAGAGTAAAGGATATTTACATTTTTAATATTTTCCAGTTCAGGTTGAAAGCACAGATAGCAGCAAGAATGG AA

AAAAAATACACAGGTTTTTTAAAAATAATGTCACATTTAATCTTGGAAACTATGTCAAAGGCTGA CTACTCCAGCTTATTCAATGATTTTGTTGAATCT

GAGTTCTTTCTGATTGATGGCGACTCCTTGCTCATCACGTGTGCGTGTGAGAGGTCACTTAAGCCAGGACAGAGTCTCCACTTCTTCTACCTGGTTGAGC

GCTACCTGTTGGATGTTATTAGCAAAGGAGGGCAATTTGCCATAGTTTTCTTCAAG GATGCTGAGTATGCATACTTCAATGTCCCCGAACTTCTGACAC

TGAGAACTGCTTTAATTCTGCATCTTCAGAAGAATACCACTGTTGAAGTTTGGACTAAGTTTTCTAACTGCTTGTCAGAAGAGTGGAATATTTGCTTGGG

TCAGAGTTGCCCATATTTCTTGATACTGGCTGATGAAGGCCTGAACGACCTGCAGACACATCTTTTCAACTTTGTAGTTATTCAGGCCTGGGCAGCAAAG

GTCAATATTGTGCTCTTCTCAGGACAGACATCTGACATCCTTCGTCTTTATGCATACTTTATGCAAAGCTCTCATGGAATGCAGATGTTCTTCAAGGAG 

AATAAGAGAATGATCATGATTGTTTACAAAAGCCTGATTCAACAGCTGGAAAAATACAGAGATATGGCTTTAGCACATCTGTTCGGAGATTTAAAATTCA

ATGATATGGAAGAGAAG GTATGTGAAACTGTATCTCTGCTGAAACAACTCTGGCCAGAAGGATCTGACATCCGATGTGTCTTTTGTGTCACCTCATGTT

CTCTCTTCTTGGAAATGTATCACTGCTACTTAGAAAGCAGAGAGAAAGGAGCATCTGAGGAGATGTCCAAAGTCAAACAG AAAACAGATAATTGCTTAA

CCCTGAAGGACATGGAAGACTTTTGTAAGCTACATTGCCTCAGTGTGGCTCTTTTGCTCCATGTACCTCTCTCTCAGAGAGCTCGCTCAAGATTCATCAC

TGCTAATTGGATTCAGGACCTCAAGACTGTCCTAAAAATG AAAAAGTGGTGCGAGTATTTTATCCTAAGTAATTTGGATATGTTTGAATCTTGGAGTCT

GAATTTACTTCACCTTTCTGACTTAAGTGATGAGCCTTTGTTGAGGAATATTGCTTTTTACTATGAAAATGAAAATAAAGAAG GCCTGGATTTGAATGT

GGGAGATGCCATCATGAACGAGTATGTACATCTCTGGGACACTGTGTCAAAGTTGGTCAGAAAGTTTGATGTGGGAAAACCAATTCCTTTGAGAACAACA

AAAGTTCATTTTCTTGAAAAGACACCATCACCAATCAAAG AAAGTTCCCAGGAGATGATGCCAAATTTAGGTTTTATTCCAATGTCATGTAATTTAGTT

GATGAATTTACTGGAGACATTTTGAAAGACTTGCCTTTCCTAATGAG TGATGACCCCATTGTTACGTCACTGGTAAAGCATAAGGAATTTGATGAGCTT

GTGCACTGGCACTCCCACAGACCTCTCAGTGATGATTATGACAGGACAAAG TGTATTGGAGATGCCA ACAGAAGAGACCCCAATCATCTTAAAAGGTT

GCAGAAGTATCATAGTTTTCAACGATTTTATGGGGAGTCATTAGAATCAGTCACTTCAAAGACCATCACAACTCAAGGTCCTAAGCCAAAGAAGGATTGT

ATTAAGTCCAAGAGCACAAAGGCACAT - UNI28882 - GAGACCAAGGCTGAAATAATTAAAAGAGAAAATAAGAAGAGGTTAATTGCTGAGGAAGA

ACAAAAAGAAGAGCAAAAATGGAATGCCCTGTCATTTTCTATCGAGGAGGAAATGAGAAAGAATGTAGACTCAGGAATGAAGAAACTGGAAGAGTTTTTG

AAATCATGTAAAAGTCGCTCAGTAAAAGCTCAGGTTGAAAGAGTTGGGTTACAGGCTTGCTTGAAAGCCTGGAAGGAACATTGCCAGGCTGAAG GTGAA

ACCACGAAAGACTTAAGCATAGCTGTCAATATGATGAAGAGGATCCATTCCTTGTTGGACAAACACTCTGAACTTCTGCAAGAAGCAGATCAGAAACTCA

TAGCCAGATGTCTTAAGTATTTAGGGTTTTGTGAGCTAGCAGTTTCTTTATATCCAACTCAG GATGCATCAGATGGCATAAAAATGAAGAAAAAGAATA

AATATTCAGTTGGGATTGGGCCGGCTCGGTTCCAACTACAATATATGGGTCATTATTTAATACGAGAAGAAAGAAAAGACCCAGACCCCAGGGTCCAAGA

TTTTATTCCTGACACATGGCAG CGAGAGCTCCTGGATGTGGTGGATAACTATGAGTCTGCAGTAATTGTTGCCCCAACATCATCTGGCAAGACTTATGC

TTCCTACTATTGCATGGAAAAGGTGCTGAAAGAGAGCGATGAAGGCGTGGTTGTGTATGTTGCACCAACAAAG GCTCTTGTTAATCAAGTGGCAGCAAC

TGTTGAATATCGTTATGCCAAAAATATGCCAGCTGGTGAATCTCTTTGTGGTGTTTTTACCAGGGATTATCGCCATGATGCCCTCAACTGTCAG GTGCT

TATAACTGTTCCTGCCTGCTTTGAAATTCTGCTACTAGCTCCTCATCGCCAAAATTGGGTGAAGAGGATCAGATATGTTATATTTGATGAG GTCCATTG

CCTTGGTGGAGAAATTGGAGCGGAAATCTGGGAGCATCTCCTTGTTATGATCCGATGTCCCTTTTTGGCCCTTTCAGCTACCATTAGCAACCCTCAGCAT

CTCACCGA GTGGCTTCAGTCAGTAAAGCGGTACTGGAAGCAAGTAGACAGTACCATGGAGGAAAGAACTGTTTCCAAAAGAACTGGTACCTCCCGTGGC

AGCTATTACAAAGATCAAGCGCAAGCCAGACAGTCCTACAAAGTTAGACTTG TGCTCTATGGAGAGAGATACAATGACCTAGAGAAGTATTTGTGTTCC

GTGAGACAGGGCGATGTTTGCTTTGATCATTTTCACCCCTGCGCTGCACTAACCATAGATCAC ATTGAAAAGTATGGATTTCCTTCTGATCTTGCCCTT

TCACCCCGAGAAAGCATACAGCTGTATGACACTATGTGCCAGGTCTGGAAGAGTTGGCCCCAGGCCCAG AGCCTATGTCCAGAGAACTTCACTCAATTT

AAGAATAAAATAGTCATTAAGAAGTTGGATGCTAGAAAATATGAAGAGAGCTTAAAGGAAGAATTCACGAATTGGGTTAAAAATGGGAACGAGGAGGAG 

GCCAGGATGGTGCTGAAGAAACTGAGCCCTGATTACCATGAGCACTCAGGGAGGATGCTGGATTTCTTTCCATGTCTTGTTGAGAAGCTAAGGAAAATGG

AGAAGTTGCCTGCACTATTCTTTTT ATTTAAGTTAAATATTGTAGAAGAATGTGCTGAAAATGCTTTCGAATTTCTGGAGAAAAAACAGGAAGAAAAAA

GACCTCCCAAAGCTGACAAAGAAGCTCGTACCACGGCTAACAAACTTCGGAAAGTTAAAAAATCTCTGGAGAAACAAAAGACAGT AGATGAAAAGGGCC

AGAAATCTTCCAGAAGATTGGATGAAAGCGTTATGCATGAAACAGAACACAATTACCTCCTGCAGACTCTGGAGAAGAATCTGGAGATTCCCAAGGACTG

CACATATGCTAATCAGAAGGCAATAGATGATCAG TTATTGCAGAGGGTGTTTCACCGGGTGAGATTCGAACGTAAAGGTGAAACACTGAAGAGGTTGGC

AGAAAGGGGCATTGGCTACCACCACAGTTCCATGAGTGCCAAAGAAAAGCAGTTGGTCGAAATTCTCTTCAGGAAAGGATTCATCAGG GTGGTGACAGC

TACTGGAACACTCGCTTTGGGAATCAACATGCCCTGTAAATCTGTGGTTTTTGCACAAAACTCAGTCTATCTGGATGCTTTAAATTACAGACAG ATGTC

TGGTCGGGCTGGAAGACGAGGGCAAGACCTGTTGGGTGATGTCTACTTCTTTGATATTCCACTGCCCAAAATAGGAAAACTCATAAAATCCAAAGTTCCT

GAACTTAGAGGACAGTTTCCCCTCAGTATTTCACTCATCCTAAGACTCATGTTGCTGGCTTCCAAGGCGGATGACCTAGAGGATGGCAAGGCAAAG GCA

CTGTCAGTGCTGAAGCATTCATTGTTATCCTTCAAACAACCCCGAGCCATAGACATGTTAAAGCTTTACTTCTTATATTCTTTGCAGTTCCTGGTGAAAG

AG GGACATATAGATCAAGAAGGTAATCCTACAGGGTTTGCTGGCCTTGTCTCCCATTTACATTACCACGAACCTTCTAATCTCGTGTTTGTCAGTTTTC

TTGTAAAAGGCCTTTTCCATAAACTTTGTCAGCCAACAAGGGAAG GCCCAAAACGTTTTTCTGAAGATGTAATGGAAAAGCTGGTTTTGGTATTGGCAA

ATCTTTTTGGAAGAAGATATATCCCAGCCAAGTTCTATGAGGTTAACTCCAAGTTTTATCAATCAAAG GTGTTCCTTGATGACCTTCCCGAGGACTTCA

GTCACGCCCTGCTTGAGTACAATACGCAAGTGACAGAAGACTTCGCTTCCTTTCTGCTAATGGTATCCCGATTGGCTGATATGAAACAGGAGTATCAACT

CTCCTTGTCAAAAATCG AGTTCACAGGTAAAGAATGTGAAGATTCGCCACTTGTGTCTCACTTGATGAACTGCAAGGAAGGAAGGGTGGCGGTTTCACC

CTTTGTTTGTCTGTCTGGAAACTTTGATGTGGATTTGCTTAGTCCAGGAGTTCCAAATCAT GTCATTCTACACACACTTGGTATCAATCACACACAAGC

CCCGGTGCTGTGGCCATACGCATTGGATAGTCAAGGAAGAAAAATTCCACTTAATGCCTATGCACTTGATTTCTATAAGCATGGATCCCTTATTGGATTA

GTCCAGGACAATAG GATACATCCAGGGGAAGCTTATAGCCTGTTGAAAGATTTTAATCTTATCATTAAGTCTATCAG TGTCTCCTTGCGTGAACTGTG

TGAAAATGAAGAAGACAATGTTGTTTTAGCATTTGAACAATTGTCTACGTCTTTTCAAGAGAAGTTTGAATTAGTGTGAAAAGAAAAACTATGTAAACTG

CTTAAACTATCACCATAGAATCATTGTGAATTATATATCTTTACTCTTATGTCTTACTCAAACAATCATACATGATGAGATGGAATGAATAAGCAAATAG

AGTTGCCATCAAACTTCTTGTGGTTGCCTCTAATGTACTTGGTGGTTTCTCAAAAAGTTGACAAAAATGCTTATATTTCTAAATTATTGAGGATTGAAGG

AAAAAAAATACAAGAATATTACATATATACATTTAAAGACAGTTTTTACACTCCATGAGACCCAATCAAATATTGCATTTTACATATTTTCACTGTTAGT

ATGTCTAAAACTACTTTTGAAGATAGAAAAAAATGATTTTAGTATCCTGAAAGTGTAATATAATCTATACAATCAACATAAAGGGATTTCACTGCTTAGA

TAGCTAGTTAATGAAATAATACCTCTTGATATAATATGAAATGTAAAATATGTATATTTTCATTGAATTTTTGTGATGCTTTTAAAGAAAACATGTAGCT

AATATTTTTCTTCATTTTAATTGTATATAAATGACTGTTG
Translation
 GPLRGNRVKDIYIFNIFQFRLKAQIAARME EKKYTGFLKIMSHLILETMSKAD DYSSLFNDFVESEFFLIDGDSLLITCACERSLKPGQSLHFFYLV

ERYLLDVISKGGQFAIVFFK DAEYAYFNVPELLTLRTALILHLQKNTTVEVWTKFSNCLSEEWNICLGQSCPYFLILADEGLNDLQTHLFNFVVIQAWA

AKVNIVLFSGQTSDILRLYAYFMQSSHGMQMFFKE NKRMIMIVYKSLIQQLEKYRDMALAHLFGDLKFNDMEEK VCETVSLLKQLWPEGSDIRCVFCV

TSCSLFLEMYHCYLESREKGASEEMSKVKQ KTDNCLTLKDMEDFCKLHCLSVALLLHVPLSQRARSRFITANWIQDLKTVLKM KKWCEYFILSNLDMF

ESWSLNLLHLSDLSDEPLLRNIAFYYENENKEG GLDLNVGDAIMNEYVHLWDTVSKLVRKFDVGKPIPLRTTKVHFLEKTPSPIKE ESSQEMMPNLGF

IPMSCNLVDEFTGDILKDLPFLMS SDDPIVTSLVKHKEFDELVHWHSHRPLSDDYDRTK CIGDAN NRRDPNHLKRLQKYHSFQRFYGESLESVTSKT

ITTQGPKPKKDCIKSKSTKAH - UNI28882 - ETKAEIIKRENKKRLIAEEEQKEEQKWNALSFSIEEEMRKNVDSGMKKLEEFLKSCKSRSVKAQV

ERVGLQACLKAWKEHCQAEG GETTKDLSIAVNMMKRIHSLLDKHSELLQEADQKLIARCLKYLGFCELAVSLYPTQ DASDGIKMKKKNKYSVGIGPAR

FQLQYMGHYLIREERKDPDPRVQDFIPDTWQ RELLDVVDNYESAVIVAPTSSGKTYASYYCMEKVLKESDEGVVVYVAPTK ALVNQVAATVEYRYAKN

MPAGESLCGVFTRDYRHDALNCQ VLITVPACFEILLLAPHRQNWVKRIRYVIFDE VHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPQHLTE EWL

QSVKRYWKQVDSTMEERTVSKRTGTSRGSYYKDQAQARQSYKVRLV VLYGERYNDLEKYLCSVRQGDVCFDHFHPCAALTIDH IEKYGFPSDLALSPR

ESIQLYDTMCQVWKSWPQAQ SLCPENFTQFKNKIVIKKLDARKYEESLKEEFTNWVKNGNEEE ARMVLKKLSPDYHEHSGRMLDFFPCLVEKLRKMEK

LPALFFL LFKLNIVEECAENAFEFLEKKQEEKRPPKADKEARTTANKLRKVKKSLEKQKTV VDEKGQKSSRRLDESVMHETEHNYLLQTLEKNLEIPK

DCTYANQKAIDDQ LLQRVFHRVRFERKGETLKRLAERGIGYHHSSMSAKEKQLVEILFRKGFIR VVTATGTLALGINMPCKSVVFAQNSVYLDALNYR

Q MSGRAGRRGQDLLGDVYFFDIPLPKIGKLIKSKVPELRGQFPLSISLILRLMLLASKADDLEDGKAK ALSVLKHSLLSFKQPRAIDMLKLYFLYSLQ

FLVKE GHIDQEGNPTGFAGLVSHLHYHEPSNLVFVSFLVKGLFHKLCQPTREG GPKRFSEDVMEKLVLVLANLFGRRYIPAKFYEVNSKFYQSK VFL

DDLPEDFSHALLEYNTQVTEDFASFLLMVSRLADMKQEYQLSLSKIE EFTGKECEDSPLVSHLMNCKEGRVAVSPFVCLSGNFDVDLLSPGVPNH VIL

HTLGINHTQAPVLWPYALDSQGRKIPLNAYALDFYKHGSLIGLVQDNR RIHPGEAYSLLKDFNLIIKSIS SVSLRELCENEEDNVVLAFEQLSTSFQE

KFELV

For any suggestions or comments, please send an email to unitrap@crg.es