Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037949 (Ano10)
Chromosomal location
Chr 9: 122084997 - 122203492 (-)
Description
anoctamin 10 Gene [Source:MGI Symbol;Acc:MGI:2143103]
RefSeq_dna
NM_133979 
RefSeq_peptide
NP_598740.1 
UniGene
Mm.87676 Mm.474116 
MGI
MGI:2143103 
Uniprot/SWISSPROT
Q8BH79 
Human Ortholog
ENSG00000160746 (ANO10)
Omim not available
UniTrap UNI2815
Vector Insertion
Chr 9: 122085597 - 122110888
Public Clones AG0465 (sanger) CMHD-GT_118H3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042546
Sequence
AGTCCGCCTTAGCGCCGCGGGCCTGGTTCTCCCCGCTCCCGCGGTCCCCGAGGACGCCGCGTGGGCGGCCG GAGGTTTGCCAAAGATGAGAGTGACTTT

ATCAACGCTGGATACTTGTGAGAGCTCCTTCACACCTCTAGTGGTCATAGAACTCGCCCAGGATGTCAAAGATGAAACCAAAGAATGGCTCAAAAACAGA

ATCATTGCCAAGAAGAAAGATGGAG GTGCCCAGCTATTGTTTAGACCACTGCTAAATAAGTATGAGAAAGAAACCCTAGAAAACCAGAATTTATACCTT

GTTGGTGCCTCCAATGTCCGACTGTTACTGGGGGCAGAAGCAGTCGGTCTGGTGAAGGAATGTACGGACGCTGCCATGCGGGCCTTCACCTATGGAACAC

GCCACAACTTTAAAGGTTTCCATG ATAACAATAATGACTTCCTCACCATGGCTGAGTGTCAGTTCATTATCAAACACGAACTTGAGAATCTTAGAGCTA

GAGACGAGAAGATGATCCCTGGCTACCCACAGGCCAAACTGTACCCTGGGAAGTCGCTGA TGAGGAGACTGCTCACGTCTGGCATCGTGACCCAAGTGT

TCCCGCTGCATGACACTGAAGCCCTGAAGAAGCTGGAGGACACGTGGTACACTCGGTTTGCTCTCAAGTACCAGCCCATAG ACAGCATTCGTAGCTACT

TTGGGGAGACAATTGCTCTGTACTTCGGGTTCCTGGAGTACTTCACCTTTGCCTTAATCCCCATGGCCATCATTGGACTGCCCTACTACCTGTTTGTGTG

GGAAGACTACGACAAGTATGTCATCTTTGCCTCGTTCAACCTCATATGGTCCACAGTGATCCTGGAGGTGTGGAAGCGTGGCTGTGCCAACATGACCTAT

CGCTGGGGGACTCTGGTCATGAAGAGGCAGTTTGAGGAGCCCCGGCCAGGGTTTCATGGAGTCCTTGGCATCAATTCAGTCACGGGCCGGGAGGAGCCCC

TCTACTCGAGCTACAAGAGACAACTGCGCATCTACCTAGTCTCTCTGCCATTTGTGTGCCTCTGCCTTTATTTCTCCCTTTATGTCATGATGATCTACTT

TGACATGGAGGACTGGGCCTTGAGTCTCCACGAGGACAGTGGGTCTGAGTGGACCAGCCTTCTGCTGTATGTACCCAGCATTGTTTATGCCGTTGTGATT

GAGATCATGAACCGCCTCTATCGATATGCTGCCGAGTTCCTAACATCTTGGG AGAATCACAGATTGGAATCTGCCTACCAGAATCATCTCGTTCTGAAA

GTGTTGGTG TTCAACTTCCTGAATTGCTTCGCCTCACTCTTCTACATTGCCTTTGTCCTGAAGGACATGAAGCTTTTGCGCCAG AGCTTGGCCACACT

CCTGATCACCTCCCAGATTCTGAACCAAGTCGTAGAATCTCTTCTTCCTTACTGGCTGCAGCGGAAGTACTGTGCGAGGGTAAAGCGGAAGGTTCAGGCA

TTAAAGTCTGAGGTCGACACAACCTTGTATGAGCAAGTCCTCCTGGAGAAGGAAATGGGAACGTACCTG GGAACCTTTGATGATTACCTGGAGTTGTTC

CTGCAGTTTGGCTATGTGAGCCTTTTCTCTTGTGTTTACCCGCTAGCAGCTGCCTTTGCTGTGTTAAATAACTTCACTGAAGTCAACTCAGATGCCTTGA

AAATGTGCAGGGTCTTCAAACGGCCATTTGCAGAACCTTCGGCCAGTATTGGCGTATGGCAG TTGGCTTTTGAAACGATGAGCGTTATATCCGTGGTCA

CTAACTGTGCTCTGATTGGAATGTCACCACAAGTGAATGCAGTCTTTCCAGAATCCAAAACAGACCTTGTTCTGATTGTGGTGGCCGTAGAG CATGCAC

TCTTGGCTCTGAAGTTCATACTCGCATTTGCCATCCCTGATAAACCACGGCACATCCAACAGAAACTGGCCAGATTGGAATTCGAATCTTTGGAGGCACT

CAAGCAACAG - UNI2815 - CAAATGAAGCTGGTGGCAGAAAACCTGAAGGAGGAGTACCAGGAAGATGGGAAGGAAGCTACCTGAGCTGCACCATG

CTGGCCGTCCTGTCCCCTGTGCTGAAGGACACCTGCATCACACCTGCACAGGGAGGGGACAGCAGCCTGAACTTAGCCCTGATGCTGGGCTGTGTGAAGT

GGCTAATATGCAGCAGGCACACCAAGGTCTAGCTCTGTGGGAAAAGTGGCTGAGGCTCTCTCTCAGTACCTCTTTCCCTGGTGCCTCTCACTCGGACCCT

CCCAGGGCCGCACACACCCTCCAGCTGTTTCATCACTTTGCTCAGGAGCCTCAGCTGCCTTTGAACGTTATCCCTAAAGAGTCACCAGCTTTCCACATGA

CATTCACAGTAGGTGCCAGTCACTTCTAACCCCAGGGACCCTATTATGGGGTGGTGGCTTAGTGTCTGTGCCCATTATACCCATGGTGGGAACCATGCTG

AGGCAGCGGTGGTCGGGGAGTAGGGGCACACCTGAATCTCCTCCTTGCTTCTGTATGGTGTTATGTTGACACTTTGCAACTGAGCTATTAAAGGCAGCCC

TTGGCTCCGACTCCTGCTTCTCC
Translation
 MRVTLSTLDTCESSFTPLVVIELAQDVKDETKEWLKNRIIAKKKDGG GAQLLFRPLLNKYEKETLENQNLYLVGASNVRLLLGAEAVGLVKECTDAAM

RAFTYGTRHNFKGFHD DNNNDFLTMAECQFIIKHELENLRARDEKMIPGYPQAKLYPGKSLM MRRLLTSGIVTQVFPLHDTEALKKLEDTWYTRFALK

YQPID DSIRSYFGETIALYFGFLEYFTFALIPMAIIGLPYYLFVWEDYDKYVIFASFNLIWSTVILEVWKRGCANMTYRWGTLVMKRQFEEPRPGFHGV

LGINSVTGREEPLYSSYKRQLRIYLVSLPFVCLCLYFSLYVMMIYFDMEDWALSLHEDSGSEWTSLLLYVPSIVYAVVIEIMNRLYRYAAEFLTSWE EN

HRLESAYQNHLVLKVLV FNFLNCFASLFYIAFVLKDMKLLRQ SLATLLITSQILNQVVESLLPYWLQRKYCARVKRKVQALKSEVDTTLYEQVLLEKE

MGTYL GTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFAEPSASIGVWQ LAFETMSVISVVTNCALIGMSPQVNAVFP

ESKTDLVLIVVAVE HALLALKFILAFAIPDKPRHIQQKLARLEFESLEALKQQ - UNI2815 - QMKLVAENLKEEYQEDGKEAT
Transcript ENSMUST00000111499
Sequence
AGTCCGCCTTAGCGCCGCGGGCCTGGTTCTCCCCGCTCCCGCGGTCCCCGAGGACGCCGCGTGGGCGGCCG GAGGTTTGCCAAAGATGAGAGTGACTTT

ATCAACGCTGGATACTTGTGAGAGCTCCTTCACACCTCTAGTGGTCATAGAACTCGCCCAGGATGTCAAAGATGAAACCAAAGAATGGCTCAAAAACAGA

ATCATTGCCAAGAAGAAAGATGGAG GTGCCCAGCTATTGTTTAGACCACTGCTAAATAAGTATGAGAAAGAAACCCTAGAAAACCAGAATTTATACCTT

GTTGGTGCCTCCAATGTCCGACTGTTACTGGGGGCAGAAGCAGTCGGTCTGGTGAAGGAATGTACGGACGCTGCCATGCGGGCCTTCACCTATGGAACAC

GCCACAACTTTAAAGGTTTCCATG ATAACAATAATGACTTCCTCACCATGGCTGAGTGTCAGTTCATTATCAAACACGAACTTGAGAATCTTAGAGCTA

GAGACGAGAAGATGATCCCTGGCTACCCACAGGCCAAACTGTACCCTGGGAAGTCGCTGA TGAGGAGACTGCTCACGTCTGGCATCGTGACCCAAGTGT

TCCCGCTGCATGACACTGAAGCCCTGAAGAAGCTGGAGGACACGTGGTACACTCGGTTTGCTCTCAAGTACCAGCCCATAG ACAGCATTCGTAGCTACT

TTGGGGAGACAATTGCTCTGTACTTCGGGTTCCTGGAGTACTTCACCTTTGCCTTAATCCCCATGGCCATCATTGGACTGCCCTACTACCTGTTTGTGTG

GGAAGACTACGACAAGTATGTCATCTTTGCCTCGTTCAACCTCATATGGTCCACAGTGATCCTGGAGGTGTGGAAGCGTGGCTGTGCCAACATGACCTAT

CGCTGGGGGACTCTGGTCATGAAGAGGCAGTTTGAGGAGCCCCGGCCAGGGTTTCATGGAGTCCTTGGCATCAATTCAGTCACGGGCCGGGAGGAGCCCC

TCTACTCGAGCTACAAGAGACAACTGCGCATCTACCTAGTCTCTCTGCCATTTGTGTGCCTCTGCCTTTATTTCTCCCTTTATGTCATGATGATCTACTT

TGACATGGAGGACTGGGCCTTGAGTCTCCACGAGGACAGTGGGTCTGAGTGGACCAGCCTTCTGCTGTATGTACCCAGCATTGTTTATGCCGTTGTGATT

GAGATCATGAACCGCCTCTATCGATATGCTGCCGAGTTCCTAACATCTTGGG AGAATCACAGATTGGAATCTGCCTACCAGAATCATCTCGTTCTGAAA

GTGTTGGTG TTCAACTTCCTGAATTGCTTCGCCTCACTCTTCTACATTGCCTTTGTCCTGAAGGACATGAAGCTTTTGCGCCAG AGCTTGGCCACACT

CCTGATCACCTCCCAGATTCTGAACCAAGTCGTAGAATCTCTTCTTCCTTACTGGCTGCAGCGGAAGTACTGTGCGAGGGTAAAGCGGAAGGTTCAGGCA

TTAAAGTCTGAGGTCGACACAACCTTGTATGAGCAAGTCCTCCTGGAGAAGGAAATGGGAACGTACCTG GGAACCTTTGATGATTACCTGGAGTTGTTC

CTGCAGTTTGGCTATGTGAGCCTTTTCTCTTGTGTTTACCCGCTAGCAGCTGCCTTTGCTGTGTTAAATAACTTCACTGAAGTCAACTCAGATGCCTTGA

AAATGTGCAGGGTCTTCAAACGGCCATTTGCAGAACCTTCGGCCAGTATTGGCGTATGGCAG TTGGCTTTTGAAACGATGAGCGTTATATCCGTGGTCA

CTAACTGTGCTCTGATTGGAATGTCACCACAAGTGAATGCAGTCTTTCCAGAATCCAAAACAGACCTTGTTCTGATTGTGGTGGCCGTAGAG GTGCTGG

GATTACAAGCGAGCTTCACCATCGGCTTTTATTAG
Translation
VRLSAAGLVLPAPAVPEDAAWAAG GGLPKMRVTLSTLDTCESSFTPLVVIELAQDVKDETKEWLKNRIIAKKKDGG GAQLLFRPLLNKYEKETLENQN

LYLVGASNVRLLLGAEAVGLVKECTDAAMRAFTYGTRHNFKGFHD DNNNDFLTMAECQFIIKHELENLRARDEKMIPGYPQAKLYPGKSLM MRRLLTS

GIVTQVFPLHDTEALKKLEDTWYTRFALKYQPID DSIRSYFGETIALYFGFLEYFTFALIPMAIIGLPYYLFVWEDYDKYVIFASFNLIWSTVILEVWK

RGCANMTYRWGTLVMKRQFEEPRPGFHGVLGINSVTGREEPLYSSYKRQLRIYLVSLPFVCLCLYFSLYVMMIYFDMEDWALSLHEDSGSEWTSLLLYVP

SIVYAVVIEIMNRLYRYAAEFLTSWE ENHRLESAYQNHLVLKVLV FNFLNCFASLFYIAFVLKDMKLLRQ SLATLLITSQILNQVVESLLPYWLQRK

YCARVKRKVQALKSEVDTTLYEQVLLEKEMGTYL GTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFAEPSASIGVWQ 

LAFETMSVISVVTNCALIGMSPQVNAVFPESKTDLVLIVVAVE VLGLQASFTIGFY

For any suggestions or comments, please send an email to unitrap@crg.es