Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000037977 (6430571L13Rik)
Chromosomal location
Chr 9: 107242971 - 107252014 (+)
Description
RIKEN cDNA 6430571L13 gene Gene [Source:MGI Symbol;Acc:MGI:2445137]
RefSeq_dna
NM_175486 
RefSeq_peptide
NP_780695.1 
UniGene
Mm.71039 Mm.400976 
MGI
MGI:2445137 
Uniprot/SWISSPROT
Q8BGK9 
Uniprot/SPTREMBL
Q14AT3 
Human Ortholog
ENSG00000088543 (C3orf18)
Omim not available
UniTrap UNI22988
Vector Insertion
Chr 9: 107243749 - 107244537
Public Clones not available
Private Clones OST279529 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042581
Sequence
AGCTGATCCTGCGCGCACGCAAGGCGGACCTTGAGTCGGGACCTGTCGCCCCCAACGCCCGGGCCTGGGTGTTCCCCCGCCCACGCCTCCTGCGGGTCAC

TACCAACCTTAGCTTCTCAGACTGAGCTCGGCGCACCGGAGAGGATTAA GTCTGCCCCTCTGCAGCACTGCTAGGACTCATTCCCACTCTGCTTTACCC

AAGACCCACAGAGGCTGGGTGATCTTCCATCCTCCGGAGGGAAATAGGTGTTTCAAA - UNI22988 - AACCGAGAGAGGCAGGGGTCTCCTGGTAA

GGGTTCTGCTGTGCCAGTGGTCATCACGGTGGCGGGAACGACAGCCTTGGACACTCCTAAGGTCAGAAGTCGGTGGGCAAGTTGACTGAGCCCTGGCAGT

CTCCCAGTGTCAGCATGAACTCCAGGGTCCCAGCTACTCAGAGCTGGTTCAGCAGCCACCTGCCCACCACTGAGCCTGACTTGGAGCCCGCCACCGCCGC

TGAAGGCTCTACCACCGAGACCGCCACCCTCAGCCCAGAAACCACAAGCTTCAATGACACCAGAATCCCTGATGTGGCAGGTGGTGCAGCTGGTGTGGGC

ACCATGCTTCTGTCTTTTGGGATCATCACAGTGATTGGCCTGGCTGTGGCCATG GTTTTATACATCAGGAAGAAGAAGAG GCTGGAGAAGCTGCGCCA

CCAGCTCATGCCTATGTACAACTTTGACCCCACGGAGGAACAAGACGAGCTGGAGCAGGAGCTACTGGAACATGGGCGAGACGCAGCCTCCATGCAGGCT

GCCGCCTCGCTGCAGGTCACACAGGGCAAG AGCACTCTCCCTTCCCAGGGCCCGCTGCAGAGGCCCAGCAGGCTGGTGTTTACCGATGTAGCCAATGCC

ATCCATGCGTGAGAGGCCGGAGAACAGGCCTGGATCTCTGACAAAGACAACGGCACGGGGCCCATCAGTGCTGCCCACTTCCTGACTGTCAAGACCTATT

CTCAGGACCAGAGCCACCACCACCACTGAGGCAGGAAAGGGCTGCAACAGACCCCAGCTGTGCTGAGGCCCCACCTAGTGACTCTCAAGCTTGCAGAGAG

CTCTGACCAGGATAGTCATTTGACCACAGACTTCTCCTGAACCCCTGGCTCTGCTGGCTTCCTGGTCTCCTGTATCCCTTGCATCAAGGTCTGCTTCCCT

GATGGGGAGGAAGAACAGAAGCTTGGAGAGGGGTGACTTGTTTTTGTGTGTGACTGGAGTCTCTTCTAGGGTAGAGATAGGCAAACAGCCAGATGCCTGG

GACAGGGCAGGGCAATACCTTTTTTTCGAGGGTGTGGGGAGGGAAGGAAGAATTTATTTTATTTTATTTTATTTTATTTTATTTTATTTTATTTTATTTT

ATTTTATTTTATTTTATTTTTGAGACAGGGTCTTGGCTAGCCTGGAAGTTGTAGACCAGGCTGGCCTCCCACTCAGGCTGCGTCTACCTCTTTGATGCTG

GGATTAAAGGCATGCACCACCACACGCAGCTAGAGCAGCGCCATTCATAAGCCCAAGAGGTGCAGGGAGAGAGCTGGGAATGCCCAGTGGATGCCCTGGG

AACCATCCATATGTAAGATACTGTGGTGAACGGGTAAGCATGAGGTCTCCCGGAAATCTCTACCGTATCCCTGGCAGCCAAAATAGCTGCTGAGAGAGAT

GAAATGGGGAGGCTGGGTATGGAAAGATGCAACTCCCCCAGATGTGGGGAAAGGCCACACACAGACAGGTACCTGTTCCAGCATGCAGGACATAGGCTTT

CTGCATTGGCTTCACCTCACAAGCTCACTCCCACTCAGTGACAGGGAGTGAAGCATTACCACAGGCAACTGCCTCTCCTTCAGTGCTCAGGGCTACGTGG

AAAAGAAACAAGACTAGGGCCCTCTGTTCACTGTGTTTCTTCAGTGAGTTCTAAAAGCTGGGCACACTTGCCTTCCTGGTCCTGGGAGAGGCTGCCACAG

GCCGGAAGCTGGTAGGAAAAGCTATGGTTGCTTGAAAGGGAGTGTCCTTTGAGGTAAAGACCTAAAGAAGCAAGTCTGACTTTAGTTTTTCCTTTCCACC

GTATCTGCAGGGAGGACCACTCAGTGTACACGGAATGTAGAATTGAGTCTGCCATTGGTCTTCCCTCAAAGTCTTGGAGGCTTGGGACTGATATTGGGAG

CATCTGGGCAGAGAAGGCCACAAAGACAGGGTGGTTTTTCTACACTGGGACATACTCGTGAGCATGCACAGAGGCGTGTCCCCAACTTCCCTGTCACCCC

TGTCCTCTGCCGGCTAGAGGGGATGCGGGGGTGGACATATGCTGCTATTGGGCAGATATCACATGTTAAGAGGTGGGGGGGGGCTCAAGAGGCGGAGGGC

TAGGAGCATCCCATGGGGAGAGGTTCTGGTTTTCTTGCTGCCTCTAGCTGCTATAAATACGTTAGCACTTGAGCAACTGGAAAGCTCTGAGTAATTTAGG

ATGCACAAAGCTGTAATTTAACTCCAGCATCTCAGTGTGCGAGAGCATTAAAGATGTAATTAAGATGTTT
Translation
  - UNI22988 - MNSRVPATQSWFSSHLPTTEPDLEPATAAEGSTTETATLSPETTSFNDTRIPDVAGGAAGVGTMLLSFGIITVIGLAVAM VLYI

RKKKR RLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASMQAAASLQVTQGK STLPSQGPLQRPSRLVFTDVANAIHA

For any suggestions or comments, please send an email to unitrap@crg.es