Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038002 (Cramp1l)
Chromosomal location
Chr 17: 25098248 - 25152171 (-)
Description
Crm, cramped-like (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1930190]
RefSeq_peptide
NP_065633.2 
UniGene
Mm.328854 Mm.473117 
MGI
MGI:1930190 
Uniprot/SWISSPROT
Q6PG95 
Uniprot/SPTREMBL
Q9JIK7 
Human Ortholog
ENSG00000007545 (CRAMP1L)
Omim not available
UniTrap UNI38599
Vector Insertion
Chr 17: 25150632 - 25152172
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37862
Vector Insertion
Chr 17: 25148246 - 25150970
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4572
Vector Insertion
Chr 17: 25134552 - 25140156
Public Clones AB0126 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32214
Vector Insertion
Chr 17: 25116430 - 25120342
Public Clones IST14758D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12437
Vector Insertion
Chr 17: 25114352 - 25114440
Public Clones A020A03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000024982
Sequence
ATGACAGTGAAGTTGGGCGACGCCGGCAGCGGGGAGGAAGGGCTCAAGAAGCTGGGCAAGCGGACGGCCGATGAGGAGTCGCTGGACGGAGAGGGGCCCG

GCGGCGCGGACGCGGCGGACAGCAGCAGCACAAAGAGGGACGGGCAGACCCCTCGGGCCTCCGGAGCCCCCGCGCCACCCAGAGGGCTGCCGACCCCGTC

TCCACCGCAGGGCAGCCCCCAGGACCAGCACCATTTCCTAAGGTCCAGCGTGCGACCCCAGAGCAAGAGGCCCAGGAAGGACGCACCCTGTGCTTTGGGC

AGTGGTGGTGCCAGCGGTTCCGGGCCGCGAGGAAAAGGTAGGGACCTATCCT TGGCAGTTTCTCTGCTGGTTCCATCTTCTAAGTCTCATTGTGATGGG

AGTTTGGGAAGAGTGACTTATGGAGAAGAGGGAGGCCCTCCTTGTTTGGTTGTCTCTGCATAG
Translation
MTVKLGDAGSGEEGLKKLGKRTADEESLDGEGPGGADAADSSSTKRDGQTPRASGAPAPPRGLPTPSPPQGSPQDQHHFLRSSVRPQSKRPRKDAPCALG

SGGASGSGPRGKGRDLSL LAVSLLVPSSKSHCDGSLGRVTYGEEGGPPCLVVSA
Transcript ENSMUST00000073337
Sequence
GCTTGGTGCTGTTGGCAGTGCTGGTTCTGGGAATGGGTTTCGCTCCCTAGCACAATGACAGGGTTTTGGGAACCGTGGTGAGGGGGTTAAAAGTGAATAG

 GATGACAGTGAAGTTGGGCGACGCCGGCAGCGGGGAGGAAGGGCTCAAGAAGCTGGGCAAGCGGACGGCCGATGAGGAGTCGCTGGACGGAGAGGGGCC

CGGCGGCGCGGACGCGGCGGACAGCAGCAGCACAAAGAGGGACGGGCAGACCCCTCGGGCCTCCGGAGCCCCCGCGCCACCCAGAGGGCTGCCGACCCCG

TCTCCACCGCAGGGCAGCCCCCAGGACCAGCACCATTTCCTAAGGTCCAGCGTGCGACCCCAGAGCAAGAGGCCCAGGAAGGACGCACCCTGTGCTTTGG

GCAGTGGTGGTGCCAGCGGTTCCGGGCCGCGAGGAAAAG GAAGTGACGGTGGTGCATCATCTTCTGGAAACGTGTCTGGGGCTACCCCTGCCACTCCTG

CAGGAGGCTCGCGCTCCTCCTCCCGGAACATAGGATCTTCAGGGCCTGAGAAAGAAGAAGGAAAGAAGGTCCGAAGGCAGTGGGAGTCGTGGAGCACCGA

GGACAAGAACACCTTCTTCGAGGGACTGTATGAG - UNI4572 - CATGGAAAAGACTTTGAAGCCATTCAGAACAACATTGCTCTAAAGTACAAGAA

GAAGGGCAAGCCTGCAAGCATGGTGAAGAACAAAGAGCAGGTCCGGCATTTTTACTACCGCACCTGGCACAAGATTACCAAATACATTGACTTTGACAAT

G TGTTCTCTCGAGGGCTGAAGAAGTCATCCCAGGAACTCTATGGTCTCATCTGCTATGGCGAGCTACGCAAGAAGATTGGGGGTT GTATGGATGACAA

GAATGCAACAAAGTTGAATGAACTCATTCAGGTTGG AGCCACCACAGTACGTTATAAAGGGAGAAATCTCCGGATCAAGGCACCCATGTGCCGAGCCCT

AAAGAAACTCTGTGATCCAGATG GTCTAAGTGATGAAGAGGACCAGAAGCCAGTGCGCCTACCCCTGAAAGTCCCAGTAGAATTACAACCAAGGAACAA

CCACGCTTGGGCACGAGTACAGAGCCTGGCCCAGAACCCACGTCTCAG GATGATTGTGGAGCTACATAGAAAAGTCTCTAGCCTCATTGAGTTCCTGAA

GCAGAAGTGGGCACTCCATGAAGTACGAATT - UNI32214 - CGGAAGACACTTGAGGAGAGGCAGCTGCAGGGTTCAAGCACAGTGCAGACCCAGG

AGAAGGTGGCATTGCACCTGTTCCCAGGCGAGAACTGCACGCTGACACCACTACCCGGTGTAGCCCGTGTGGTACACTCCAAGGCCTTCTGCACTGTACA

CTGGCAAGAGGGTGGCCGGTGCAAACAGGGCACTAAGGACATACACTCACTGCCTCCAGCACAGATCCTCGGCATCCAGAGTGGACAGGGAATAGCCCGG

GGCCAGCTGAAGTGCCAGAGGAGCAGTGCTGAAGGCAAGGGTGGGGGGCGGCTCCTTCCCACTGCAGATGCTTCACAGAGCTCAGGGGAAAGTTCCCCTG

AGAGTGCTCCTGCAGAGGGAGCAGCTCCAAGTCTGAGCAGCCCAGATGCCCCCGACAGGCCTCATGGGCTCCAGGACTCTGGACCACACCTTGAGAAGAC

CCCTGTGACAGCCCTTGCAGTGGGTAGGGACAGCCCTATTCAAGAATCTGGGGCCCTGCCGTGTCCCTGTGGCCAGCCCCCAGACTTGGAAGATGAACTC

TCACTCCTTGACCCCTTCCCCCGATACCTGAAGTCGTGCCAGGATCTCATCATCCCAGAGCAGTGCCGCCGTGCAGACACACGATCTGGGAGAGAGCATC

CTCCTCTCGGCAGCGTAGCTTCCCCAGAGACCCTCACACCCAGCAGCGGGGCGGTCGCTGACAGTGCTCCCCCTGGCCTGGACCCTCAACCTGGCACTGA

TCATCAACCTGACACCAGGCTTCAGTCAGATATTTGTACTAAAGAGCTAGCGAACGCATCCTCTGAAGAGTCCCAGGAAAAAGGCAGCCCCTCAGAACAT

CTGTCGTCTCAGGGACAGCCTGCTACCAGGCCTTCCAAGGAAGTCCCTGCCAGCCAGCTGGCCCAGCAGCTACGTGAAGAAGGCTGGAGCTTGCAGACCT

CTGAAAGCCTCACACTGGCTGAAGTCTACCTCATGATGGGCAAGCCGACCAAACTGCAGCTGGAGTATGATTGGCTGGCTGTGCTGGGCCCCGAGAGCCA

GGCACCCACAGCACAGGGCCAGACTGCACTATCCCGCTCCTCGCCCTCAGCCCTCCACCAGCAACGCCTCCTGAGCTGCCTTCTGAGGCTCATCTCCACT

GAGGTCCACCCCAAGATG - UNI32214 - GCTTTTGAAGCAAACACAGCATCAACGGCTTCAGTCAGGCCCACCCAGGAGGAACAGTCCACAACTCC

ACCAGGGAAGGTAGTGACCATCAACTCTCGGAGTCCCCGCTGTTCTCGAAACCCATCTACCCTCCGAAGCAACAAGACTTTCCCATCTGCTTCTGCCCCT

TGCTCCCCAG - UNI32214 - GTTTGAGAAACCCCCCAAGGCCTCTCTTGGTGGCTGGTCCCTCCAGCACAGGAAGCAGTGACTCAGATGGTGGCCT

CTTTGCTGTCCCAACGACTTTGCCACCAAATAGTCGACATGGAAAGCTCTTCTCTCCCAGTAAGGAGGCGGAGCTGACTTTTCGGCAGCACTTGGACTCC

ATCAGC - UNI12437 - ATACAGTCAGACTTTTTCTCACCAAAGCCCAAGAAACTACGGAAACGGCACTTAAGAAAGCCACTGGTGGTCCAG AGGA

CACTGCTCCCTAGACCTTCTGAAAACCAGTCCCACAATGTGTGCTCCTTCTCCATCCTGTCTAACTCTCCTATAGCTG GGAGAGGCTGGTTCCGGCCCA

TCCAGTCTTCTTTGACCAAAGCAGCTCTGTCTCGACCGATAGTGCCCAAGGTCCTCCCATCTCAGGCCACCAGTCACCTGCCCA GTGCCATCGACTTAG

CAGCTCAAAGTGCTGGCATCATCCCTGGAAGTCCCTTGCCAATTTTAGATACTGATGGCTCATCTGGCATCTCTCCACTGTCTTCAGAACAAGCAACCAC

TGCCATCTCGGGGCAGGGTGACACTGGACCACACCAGAACAGAGACCCTGTTACTGCTGTAAGG GGCACTAATGACCCATTTATCAGTGTTACAAGACC

AGAGCAGGAGCCAATGACAGATGGTTTCCAG GGATCACCTGCTCTGACCTTACCTGAGCTGTCCAAGGCTAATCTCCAGAATGGCCTGTCCATACCTTT

ACCCTCATCGGAGAGCTCCAGCACCCGTCTCTCCCCACCCAATGTTTCTGCACTGCTGGACATATCCCTACCTGGTCCACCTGAGGATGTTCTCTCACAG

GGAGAACCTGCCACACAGATCAGTGACTCCATCATTGAAATTGCCATCAGCTCTGGCCAGTACA GTGAAGGAGTTCCCCTTTCTCCAGCAAAACTGAAC

GGCAGTGACAGTTCCAAGAGTCTTCCCTCCCCATCTAGCAGCCCCCAGCCCAACTGGATTGCCTCTCCCACTCATGATCCCCAGTGGTATCCCAGTGACT

CTGCAGATTCCTCACTCAGCAGCTTGTTCG CCAGCTTCATATCTCCAGAGAAGAGCAGAAAGATGCTACCAACTACTGTTGGGGCCAACAGCGGCACAT

CTTTGCTTGGCCCTAGCTTGTTGGATGGAAATTCAAGGGACTCTTTTGTGTCCAGGTCTCTGGCTGATGTTGCAGAA GTGGTGGATTCCCAGTTGGTGT

GCATGATGAACGAGAACAGCATTGACTACATATCTCGGTTTAATGACCTGGCCCAAGAATTGTCCATCACTGAGCCTGGCCGCCGGGAGGTTCTTTTTGA

TGGTGGAGGAGGTGGTAATCCTGTTGGTGACCTCTCTCAGTGACTATGCTTTGTGACACGGGCATCGTGGAATCCACAAAGGAGGTCTACGGAGCTGGTC

CCATGAATCTGTCTGCACAGTAGAGAAAGTCAAGCCCAGAATCCTGAGAAGACAGTGAACAGGAGCACCTCTAACAGCATAACAATATCCACATGCAAAG

GACAGCCTGTGCAACAAGTAGGGGTTGTACCATCCACAGAAGCCAGGACAGCTGACCCGAGAAGGGTAGACCTCAGAAATCCTTTTGGTATCAGAGCCCT

TGAAGTCCTGTAGCCTGTGTGGCGTCCTGACTGTATGTCTGTCTGTGTGTTGAGCCTTCCAGGGGGTCTCCTCCTTGCAAGAGGAGTTCATTTGCCTGGT

GTTCATTTTGTCTTTGGAGCTGTTATCCATGCGAAGGGAGGCCATAGCCACTGCTGCTTTCTTTCTGATATCTTTTTTCCACTTGGCTGTTCTGTCTGCA

GTGATGTTGCAAGGGACTGTGAGTATAGTCCAGTCTATTGCCTGGTGGTATCTTCAACCTAAGATACTTCCTGGTTGCCTTGACCATGAAGCAGAGAAGG

GTCCCAGAGCCATGTAGATAATGGTATCTTCCCAAGACTACTTAGCCCTCAACTAGTGCTTCCTACCCAAACCATCCAGAGGTGTGGTTCTGCCTGGCAT

GAGGAAGGGGGAAGAAATTTTGTTTCTTGGAGCTTGTATGGATGTTTTGTATGGTCTTTCAAAGCTGGTTGGGAATGGCTTTCTTGCGGTTTAAGAATTG

AGAGATATGGACAAGGAATAGTAAGAGTCCTTTATTTAGGTGGCTCTGCTTTCTACCTATGCTTAATGCCTAGTTCCTTCTCTCTCTCTCTCTCTCTCTC

TCTCTCTTTCTTTCTTTCTTTCTTTTTTTTTTTTGGTTTTTTGAGGCAGGGTTTCTCTGTGTAGTCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGC

TGGCCTTGAACTCAGAAACCCGCCTGCCTGTGCCTCCCAAGTGCTGGGATTAATGTTGTGCGCCACCACTGCCCAGCCTAGTTCCTTCTAAGTGATCTGA

GATACCATTTCTCTCTAATGGCCTGACCCTACCCCAACCCCCAAATGCACTGCAATGTCTACAGATTTTATCCACACTTAAAATTTCATGTGTTATTGCT

GGTATCTGAGGGGTGTCTTTGCCCCAGGCTATCTCTCTTCCTATTCTGGGACCCAAGCCAGGTTTAGATGTCAGGGTGTAGGAAGAGCTCACAGCTTGAT

GATGTTTTAGCAGCCCTCTTCAGGAGCCCAGAGGTGGTCAGTCAGTTGTCATGCTCAGGCCATCGGACTCAGAGTGGTGCCAAAAATACTTCCATTCCCC

TTCTTTGCCCTTTAGTAGATTCTTGTAACATGGTCACTCTTGCTGGACCTAGCATATCAGGTAGCCATGGCTATTTCTTGTTGAACAGGTGACCCCTGTG

CTAGCCACGTCACTGCTCACTCTCCACATGCTAGCCAGGGCTGACACCCCTCCCACCCCACCCCACCCCACTCCACCCCCTTTCCTTTTTCTTCTGAGAC

AGGGTTTCTCTGTATAACCCTGCTATCCTATAACTTGATTTATAGACTGAGTTGGCTGGAGATCTACCTGCCTCTACCTCCTGAGTGCTGGGCTGAAAGT

AATGTGCTACCACACCAAGCTTGGCAGGTCCTTGTAACTCCTAAAGCTGCCACCTCTGTTTTCCAGCTGTTCTAGCCTCCTTCCTTGCACAGTAGTACTT

AAGATCATCCTAGGCCCTTACGTCTCTCTGTCTGCAATGAAGAAAGGGATGGGAATGTCCTTTTGGGACACTTGATCCAGTTGCCTCTCTGGCTACTACA

AACCCTAGAGTGCAGGCTCTGCTCCAAAGACCGTATAGGGCTCTGGTACTGGTGAAGGATCTGTCCCAGATGCTGACATGCAGACCCCACATCTGGTAAG

AGTCAGACTGTTAGATGAGAAGCGCAAGCATATGGTGCCGTCAAGAGACTGTGGTAAGGTAGCCAATGTGTCTCTACCCAGTTGTGTGCTTTCAGCAATG

CCTTACTTAGCTGAAGGCATTTAGATCTTGGGACTGTAGCCTGTACCAGGCTAGGCTCAGGCCACTGCTAGCTGCTCTTCCTGTGTTTCAGGTAGACTCT

CCCACAACATTAATAAGCATGGGTGCTTGTAGAATCCTGGTAACTGCGCATGTAGAACTAGGTAGTTGGGCTCTTAAGCTGGTTTCCATGAGGCAGTGAA

TGCTGTAGGCACATGTTAGTCTGTGCCGGCTAAAAGGAGTTGAGACGTCTTGAGGAGCAGAGACTACAGCCCTTGTCTCCCAGTAGCAAGCGGCATCAGA

TGGACTGGTGCGTTACTGTAAGGAAGCTGACAAGATTCCAGAAGGTTCTTCACCAGCCATACTGGTTTGCTCATCATCGCCACATTAAAGGACAAATGGT

GGCATTTGTAGCAGAGAATCAGTGGATACAACGTCTCCCAGCGTAAGCAAATATCCATGCATAAAACCTGAAAACTGCTAAAGGTTAGAGTTTTTTAAAA

AACAAAACAAAAACAGCAAGGCAGGCTCCTGGGTTCTACATCTTCCTTCTCTTCCTTCCATCAGTTTGGATGGTTGGCGTTCACTCGGGCTTCCTCTCCT

CATTGGAACTTAGTGTGACTTACATGCGGTCATTCTTTGAGAAAATCTTTTGTTAATATTAATGTTTCTTAGACATGTTGATTCATCTTTTTAAAAGATG

GGGAACCTGTATCTTTGGTGCTTGGCATGGATTGTGTCCTAGAGAAGATGCTCAGGCGAGCTGAAGTCCATAGATCCTGTCGGGCATAGTACTTGCTCAG

GGAGTGGGACTTTGGGACATTTCATCTGTTGGTCAACCTTTTTTCCTACCCTCCTCTTCTTTTTCATTCCTTGTGATAGCCTCTGCTAGGGGAGGTGTCA

TTCAGTTCAATAGCATTTTTAACCAAACCATATTATTAGAAATGGTCAAAATAAGTTTAGAAGGAAATTGTTTTATGTACTTTAAAAACAAATCTCCCAG

ATGCATTCATGAGGAAATACCGTACTTTGTCTTAATTTAAAAAAAAAAAAAAAACACTTTAAAAAAGGAAAGAAACCCACAGTATACCTTTCCCAGAGGC

TAGCCTGGTGTGGTCAGTCCAGTTTTGGAAGCACTGCCCCAGCCAGACCCTTATTCTTTCGTAAGATCACTGGCTGGAGGGGTGCCCCCAGCAGGCAGAG

CTCAGTGCTGTTTGCTTTGATAATCGTTAAGCCATATCATCTGAGGTTTCCGGCTTGAGATGTGAATTTGTTTTATAGACTATAAATATACAGTGTATGT

ATAAAGCAGAATGCCTGTCCTTCTGATTATTTTTTGTACCATATTGTAAATTACATTATTTATTCTTTACCAATTTTTTGGGAATAAAAGGTGTTTTGGT

TATTTAATAAACAAGAACTGTT
Translation
 MTVKLGDAGSGEEGLKKLGKRTADEESLDGEGPGGADAADSSSTKRDGQTPRASGAPAPPRGLPTPSPPQGSPQDQHHFLRSSVRPQSKRPRKDAPCAL

GSGGASGSGPRGKG GSDGGASSSGNVSGATPATPAGGSRSSSRNIGSSGPEKEEGKKVRRQWESWSTEDKNTFFEGLYE - UNI4572 - HGKDFEA

IQNNIALKYKKKGKPASMVKNKEQVRHFYYRTWHKITKYIDFDNV VFSRGLKKSSQELYGLICYGELRKKIGGC CMDDKNATKLNELIQVG GATTVR

YKGRNLRIKAPMCRALKKLCDPDG GLSDEEDQKPVRLPLKVPVELQPRNNHAWARVQSLAQNPRLR RMIVELHRKVSSLIEFLKQKWALHEVRI - U

NI32214 - RKTLEERQLQGSSTVQTQEKVALHLFPGENCTLTPLPGVARVVHSKAFCTVHWQEGGRCKQGTKDIHSLPPAQILGIQSGQGIARGQLKC

QRSSAEGKGGGRLLPTADASQSSGESSPESAPAEGAAPSLSSPDAPDRPHGLQDSGPHLEKTPVTALAVGRDSPIQESGALPCPCGQPPDLEDELSLLDP

FPRYLKSCQDLIIPEQCRRADTRSGREHPPLGSVASPETLTPSSGAVADSAPPGLDPQPGTDHQPDTRLQSDICTKELANASSEESQEKGSPSEHLSSQG

QPATRPSKEVPASQLAQQLREEGWSLQTSESLTLAEVYLMMGKPTKLQLEYDWLAVLGPESQAPTAQGQTALSRSSPSALHQQRLLSCLLRLISTEVHPK

M - UNI32214 - AFEANTASTASVRPTQEEQSTTPPGKVVTINSRSPRCSRNPSTLRSNKTFPSASAPCSPG - UNI32214 - GLRNPPRPLLV

AGPSSTGSSDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLDSIS - UNI12437 - IQSDFFSPKPKKLRKRHLRKPLVVQ RTLLPRPSEN

QSHNVCSFSILSNSPIAG GRGWFRPIQSSLTKAALSRPIVPKVLPSQATSHLPS SAIDLAAQSAGIIPGSPLPILDTDGSSGISPLSSEQATTAISGQ

GDTGPHQNRDPVTAVR GTNDPFISVTRPEQEPMTDGFQ GSPALTLPELSKANLQNGLSIPLPSSESSSTRLSPPNVSALLDISLPGPPEDVLSQGEPA

TQISDSIIEIAISSGQYS SEGVPLSPAKLNGSDSSKSLPSPSSSPQPNWIASPTHDPQWYPSDSADSSLSSLFA ASFISPEKSRKMLPTTVGANSGTS

LLGPSLLDGNSRDSFVSRSLADVAE VVDSQLVCMMNENSIDYISRFNDLAQELSITEPGRREVLFDGGGGGNPVGDLSQ

For any suggestions or comments, please send an email to unitrap@crg.es