Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038007 (Asah3l)
Chromosomal location
Chr 4: 86520360 - 86566778 (+)
Description
N-acylsphingosine amidohydrolase 3-like Gene [Source:MGI (curated);Acc:Asah3l-001]
RefSeq_dna
NM_139306 
RefSeq_peptide
NP_647467.1 
UniGene
Mm.45019 
MGI
MGI:1920932 
Uniprot/SWISSPROT
Q8VD53 
Uniprot/SPTREMBL
A2BDY6 A2BDY7 
Human Ortholog
ENSG00000177076 (ASAH3L)
Omim not available
UniTrap UNI33583
Vector Insertion
Chr 4: 86532177 - 86532927
Public Clones IST14780C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30876
Vector Insertion
Chr 4: 86546524 - 86557519
Public Clones IST14956E9 (tigm) IST14956F9 (tigm) IST14261F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30993
Vector Insertion
Chr 4: 86557658 - 86563297
Public Clones IST11706C6 (tigm) IST11671H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000084433
Sequence
GCAGAGAAGCTGCTCCGATGCTCCAGAGCGGCCATGGGCGCCCCGCACTGGTGGGACCACCTGCGGGCTGGCAGTTCGGAGGTGGATTGGTGCGAGGACA

ACTACACTATCGTGCCTGCCATTGCCGAGTTCTACAACACG ATCAGCAACGTCTTGTTTTTCATTTTACCTCCCATCTGCATGTGCTTGTTCCGCCAGT

ACGCAACGTGCTTCAACAGCGGCATCTACTTAATATGGACGCTCCTAGTTGTAGTGG - UNI33583 - GGATTGGATCTGTCTACTTCCATGCAACG

CTGAGTTTCCTGGGTCAGATGCTTGATGAACTTGCCATTCTGTGGGTTCTGATGTGTGCTTTGGCCATGTGGTTTCCCAGGAGGTATTTACCAAAGATCT

TTCGGAATGACAG - UNI30876 - GTGTGACAATGTGCGTGTGTTTAAGCTGGGCCTCTTCTCTGGCCTCTGGTGGACTCTGGCTCTCTTCTGCTGG

ATCAGCGACCAAGCCTTCTGTGAGCTGCTCTCCTCCTTTCACTTCCCCTACCTGCACTGTGTGTG - UNI30993 - GCATATTCTCATCTGCCTTGC

TTCGTACCTGGGCTGTGTGTGCTTCGCCTACTTTGATGCTGCCTCAGAGATACCTGAGCAAGGTCCAGTCATCAGATTCTGGCCCAGCGAGAAATGGGCT

TTTATTGGTGTCCCTTATGTGTCCCTTCTGTGTGCCCACAAGAAGTCGCCAGTCAAGATCACGTGATGGCAAGGCAGTGACCAGCTTCTCTACTTACTTC

TATTCGAGTGCGCGCTGGGCTTCGTTTGCTAGCAAAGATGGCTGAGGGGGTTGAGGAATTGGTGTGGTGTGGGTGTTTAAAATTCTGCTCCTTTGTGATC

TAACTGGACCACTGTGCCTGACCTCCCTAGGTTAAGTAGAGGGCTCAGGGACATAAGGTGTCTTCCTCAGTATCCTTTCCAGGCATACGGGCTTGCTGGG

TTATGTCCATAATGACATCAACAGAGTAGTTCTTTGGGAGACCTAGGGCAACCCAAAGTTTCTTGCTGGAGAGGGTAGCTTGCTGTTTCCACCATTTCCA

GACTCTCAACCCCCTGATAAACAAGACCTTCTGATTTGGTGATGAAAGGTTCCAGAACTTTTCATTTTGCCGGGAGAAACTGTCCTTCAACAAAACCAAG

TGGGCAAAACACGTGTGGGGGGTGTGACTAAGACGGGTGGCTTGTCACTCGCACCTCTTAGCTTTCCCAGGTTCTCCACGTGTTTGTGGATCCTTCCACT

ACCTCTGCTGAGAGATGGAGCCACGGCTTCAGAGGGCAAAGCTGGCAACACCCTCTATGCCAAAAGCTACACTCCTCTTTAAGCACACATTACATATAGA

CACTATTTCTGCTCTTCCAGAGTGCAGCAGCCTCAGACCCACAGAGAATCCTTCAGGTTATGTGAAGATTCCACACACAGCCCCCTCTTGTGACCTCTGT

GAGAGCAAGGCCTCGTTGTAATCGCGGAGGCAGCTCTGGAGGCTTGACTGTGGAGCGCCTGTGAAGATTTTGGAAAGCTTTTCTTATTGGAAGCTTTTGG

TGTGTCGTTACCTCCAAGATTCTGACCCCGTTTCTCTGCTGTTTTTAGGGGATATGTGCTTCCTGAGTGACGTAGCCTCCCTAGGATGTGGGCCTCCGGC

TTTTGTTTTCATAATACCTGGTGCTAACTGGTTTCTCAGAGCACTTTGCTCTTCTTGATGCTGGGCGGTCACTACACTCTGATTGGCTGGCTGGGGATCC

CAGGGAGGAAGGGGCAGACTCTGACATGAATGTCTCTCACCTGCATCCTACTGTCTTCACTGGGCTCTCTTCAGGGTATGAAGTGGGTATGGGGTATCTC

AGGGATGTTTGTAACTCAGGCACCTTCTGCTTTCTGACATTCCATTGTCAGTGGTGAGACTGCACTCAGGGGACTGGAGTTGGAACACCGTTCTGAGTGG

TGTCCTGAGTCTGAAGGAGCTAGCTGCGGGTTCTGGCACTTCTAGGATCTCTTACTCTGTTTAGAACCTTCACAGGGTACAAAGTGGGAACTGGACTTAA

AGAGTTTTTAAATGAATAGACTTCATTCTGCTTTTGTGGCTTTGGAGTTTTAGAAGTAACTTGCTGGGCTATTTCTTGTTTATAGTCACAAATATTTATA

GAACATGAAGGTGTAAAATAAGTTGTCTTTTATTAAATTCATAGCATTTACCAACTCTCCCAGGTAGCAAACACACAGTCATTTGATTGGCGATTTACAA

GGCAGGAATACTTGGTTTTGAATGATTGTATATGTCATTTTACTGTAGCTTAAAATATGTTTAAAATGACTTTGAGTGAAATGTTTGTGGCAACCTAGGG

GTTTATGGATCAGAATTGCGGCTGAGTCCTTTGGTTTTTGAGTCTAGAAGTTTTCAGAGGGCAAAATCAAACTAGCCTTGTTTCTGGTTCATCTTACCAG

GCTCGGGAGCTGCCCTTATATATTCTACATAAGGACTTATTATACATAAGTCTGTATAAATGTCCTGAAGATGACACCTAGCTGCCTTCATCTGGAAGGG

TCGTCTGGGGCTGGAGAGTTGGTTCAACAGTTAAGAACCCGTGTTGCTCTCTCCCAGACGACCCAGCGACTTGTGAGGCTCATAACCAGCAACTCCAGCC

CTGGGGCATCTGACGCCCTCTTCTGACTTCTAAGGGCATTTGGTGCACACGTACATACAGGCAGGCAAAACATTTATACATGTAACGTAATAAATGCATA

AGTTAGTGAGACGGCTGAAGGAAAGGAGTTTTAGATGCAAGGTTTAGTCTGACCTGAGTGCCCTTCCTTAGCCGCGATGGTGTCCTCAAAGTCAGGGAAG

AACCATTTCTTTTTTATCAGGAAAAGGACTTATTCCCTAGGGCCTCTGCTGACATCCCTAGGAACAGAGATAAAATACGGATGGATGTGAATGAACATGC

TTGGGTGAAAGGAGCCGAGTACCTGACTGGACCCAGTGGGCCACTTCCACAAGCGAAGCCCGGTAACCGATGTGCACTCCAGAATCTTCTCCCTTCTGGT

AGAGATGACATCGATGAGTGATGTCGTGACCACTGGGCCCTGCATGGGTGTCGGGCTCTGTTCTGTTCCGAATCTACCTGAGATCTCAGGACAGAGGAAG

CCATGAATGTTACCAAGTGGTCATGGCTGTCAGTGATTTTACAGTTTTGAACCATTATTGGTTTTTAGGAGAATTCTTCTCTCTCTAGTGCCCTGTGATG

CCAAAGCCAGCCCTTCAGAAGTGTTCCTTCTGTCTGCTTCCCTTTGTAATGTGATCCACTCGGGGAAATGGGTGTCTACCCAGGGAAAAGTGCCTACCCC

AGTCACGGGTCAACAGTGTTGTGTTGAGGATCAAACATGGCTCTGTGAAAATACTGCCACCCATTCTATTGGTTGGATTTCTCAGGAGTCTGAATCTTCC

CTCACGAGTCCTCTTCTCCCAACCCCTACCCAGAGCCAACACTGGGATTTGAACCTTCTCTGACTCTCTTCTTCCCTCAGGTCTGACAACTAATGGTCTC

TGGGGACACCCAGCTAGGGCCTTCCCCAACTCCTTATCCAGCTGAACTTGGATTCTTCCCAACCAGGGCTTGACCTGGGTGCTGTTGGTCCCACTGGCCA

ACAACACATCTTTGGCCAGATTGGGATTCTCAATAGATTTTATAGACATTATTCTCCCACAGACTTTAAAACATGGCTTGTGTCTTTCCATACACATCCG

GTCAGATTTAAAACTATTTTATAACCACAGGAATTAAACCAAGCAAATAGAGTACTTTCAGATATAAACTGTGTTTCATACTTTATGTAGAGTGTGCTAT

GTATAGGCGGTATGTACCCTGGCTGAAGTAATATTAACCATAGCTCTGGGAGGATTTACAGACCTTTTGCACTTTATGCTTTTTTGTGAACTCTGATAAC

CATGGTCAATATTAAAGCCAATAACTGGCATTTTCTGTGAATAAACATGCATATGTATCT
Translation
MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNT ISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVG - UNI33583 - GIGSVYFHAT

LSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRNDR - UNI30876 - RCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVW 

- UNI30993 - WHILICLASYLGCVCFAYFDAASEIPEQGPVIRFWPSEKWAFIGVPYVSLLCAHKKSPVKIT
Transcript ENSMUST00000045224
Sequence
GCAGAGAAGCTGCTCCGATGCTCCAGAGCGGCCATGGGCGCCCCGCACTGGTGGGACCACCTGCGGGCTGGCAGTTCGGAGGTGGATTGGTGCGAGGACA

ACTACACTATCGTGCCTGCCATTGCCGAGTTCTACAACACG ATCAGCAACGTCTTGTTTTTCATTTTACCTCCCATCTGCATGTGCTTGTTCCGCCAGT

ACGCAACGTGCTTCAACAGCGGCATCTACTTAATATGGACGCTCCTAGTTGTAGTGG - UNI33583 - GGATTGGATCTGTCTACTTCCATGCAACG

CTGAGTTTCCTGGGTCAGATGCTTGATGAACTTGCCATTCTGTGGGTTCTGATGTGTGCTTTGGCCATGTGGTTTCCCAGGAGGTATTTACCAAAGATCT

TTCGGAATGACAG GGGCAGGTTCAAGGCAGTGGTGTGTGTCCTGTCTGCAATTACAACGTGCTTGGCGTTTATCAAGCCCGCCATCAACAATATTTCCC

TGATGATTCTGGGACTTCCATGCACTGCGCTGCTTGTTGCAGAGCTGAAGAG - UNI30876 - GTGTGACAATGTGCGTGTGTTTAAGCTGGGCCTC

TTCTCTGGCCTCTGGTGGACTCTGGCTCTCTTCTGCTGGATCAGCGACCAAGCCTTCTGTGAGCTGCTCTCCTCCTTTCACTTCCCCTACCTGCACTGTG

TGTG - UNI30993 - GCATATTCTCATCTGCCTTGCTTCGTACCTGGGCTGTGTGTGCTTCGCCTACTTTGATGCTGCCTCAGAGATACCTGAGCAA

GGTCCAGTCATCAGATTCTGGCCCAGCGAGAAATGGGCTTTTATTGGTGTCCCTTATGTGTCCCTTCTGTGTGCCCACAAGAAGTCGCCAGTCAAGATCA

CGTGATGGCAAGGCAGTGACCAGCTTCTCTACTTACTTCTATTCGAGTGCGCGCTGGGCTTCGTTTGCTAGCAAAGATGGCTGAGGGGGTTGAGGAATTG

GTGTGGTGTGGGTGTTTAAAATTCTGCTCCTTTGTGATCTAACTGGACCACTGTGCCTGACCTCCCTAGGTTAAGTAGAGGGCTCAGGGACATAAGGTGT

CTTCCTCAGTATCCTTTCCAGGCATACGGGCTTGCTGGGTTATGTCCATAATGACATCAACAGAGTAGTTCTTTGGGAGACCTAGGGCAACCCAAAGTTT

CTTGCTGGAGAGGGTAGCTTGCTGTTTCCACCATTTCCAGACTCTCAACCCCCTGATAAACAAGACCTTCTGATTTGGTGATGAAAGGTTCCAGAACTTT

TCATTTTGCCGGGAGAAACTGTCCTTCAACAAAACCAAGTGGGCAAAACACGTGTGGGGGGTGTGACTAAGACGGGTGGCTTGTCACTCGCACCTCTTAG

CTTTCCCAGGTTCTCCACGTGTTTGTGGATCCTTCCACTACCTCTGCTGAGAGATGGAGCCACGGCTTCAGAGGGCAAAGCTGGCAACACCCTCTATGCC

AAAAGCTACACTCCTCTTTAAGCACACATTACATATAGACACTATTTCTGCTCTTCCAGAGTGCAGCAGCCTCAGACCCACAGAGAATCCTTCAGGTTAT

GTGAAGATTCCACACACAGCCCCCTCTTGTGACCTCTGTGAGAGCAAGGCCTCGTTGTAATCGCGGAGGCAGCTCTGGAGGCTTGACTGTGGAGCGCCTG

TGAAGATTTTGGAAAGCTTTTCTTATTGGAAGCTTTTGGTGTGTCGTTACCTCCAAGATTCTGACCCCGTTTCTCTGCTGTTTTTAGGGGATATGTGCTT

CCTGAGTGACGTAGCCTCCCTAGGATGTGGGCCTCCGGCTTTTGTTTTCATAATACCTGGTGCTAACTGGTTTCTCAGAGCACTTTGCTCTTCTTGATGC

TGGGCGGTCACTACACTCTGATTGGCTGGCTGGGGATCCCAGGGAGGAAGGGGCAGACTCTGACATGAATGTCTCTCACCTGCATCCTACTGTCTTCACT

GGGCTCTCTTCAGGGTATGAAGTGGGTATGGGGTATCTCAGGGATGTTTGTAACTCAGGCACCTTCTGCTTTCTGACATTCCATTGTCAGTGGTGAGACT

GCACTCAGGGGACTGGAGTTGGAACACCGTTCTGAGTGGTGTCCTGAGTCTGAAGGAGCTAGCTGCGGGTTCTGGCACTTCTAGGATCTCTTACTCTGTT

TAGAACCTTCACAGGGTACAAAGTGGGAACTGGACTTAAAGAGTTTTTAAATGAATAGACTTCATTCTGCTTTTGTGGCTTTGGAGTTTTAGAAGTAACT

TGCTGGGCTATTTCTTGTTTATAGTCACAAATATTTATAGAACATGAAGGTGTAAAATAAGTTGTCTTTTATTAAATTCATAGCATTTACCAACTCTCCC

AGGTAGCAAACACACAGTCATTTGATTGGCGATTTACAAGGCAGGAATACTTGGTTTTGAATGATTGTATATGTCATTTTACTGTAGCTTAAAATATGTT

TAAAATGACTTTGAGTGAAATGTTTGTGGCAACCTAGGGGTTTATGGATCAGAATTGCGGCTGAGTCCTTTGGTTTTTGAGTCTAGAAGTTTTCAGAGGG

CAAAATCAAACTAGCCTTGTTTCTGGTTCATCTTACCAGGCTCGGGAGCTGCCCTTATATATTCTACATAAGGACTTATTATACATAAGTCTGTATAAAT

GTCCTGAAGATGACACCTAGCTGCCTTCATCTGGAAGGGTCGTCTGGGGCTGGAGAGTTGGTTCAACAGTTAAGAACCCGTGTTGCTCTCTCCCAGACGA

CCCAGCGACTTGTGAGGCTCATAACCAGCAACTCCAGCCCTGGGGCATCTGACGCCCTCTTCTGACTTCTAAGGGCATTTGGTGCACACGTACATACAGG

CAGGCAAAACATTTATACATGTAACGTAATAAATGCATAAGTTAGTGAGACGGCTGAAGGAAAGGAGTTTTAGATGCAAGGTTTAGTCTGACCTGAGTGC

CCTTCCTTAGCCGCGATGGTGTCCTCAAAGTCAGGGAAGAACCATTTCTTTTTTATCAGGAAAAGGACTTATTCCCTAGGGCCTCTGCTGACATCCCTAG

GAACAGAGATAAAATACGGATGGATGTGAATGAACATGCTTGGGTGAAAGGAGCCGAGTACCTGACTGGACCCAGTGGGCCACTTCCACAAGCGAAGCCC

GGTAACCGATGTGCACTCCAGAATCTTCTCCCTTCTGGTAGAGATGACATCGATGAGTGATGTCGTGACCACTGGGCCCTGCATGGGTGTCGGGCTCTGT

TCTGTTCCGAATCTACCTGAGATCTCAGGACAGAGGAAGCCATGAATGTTACCAAGTGGTCATGGCTGTCAGTGATTTTACAGTTTTGAACCATTATTGG

TTTTTAGGAGAATTCTTCTCTCTCTAGTGCCCTGTGATGCCAAAGCCAGCCCTTCAGAAGTGTTCCTTCTGTCTGCTTCCCTTTGTAATGTGATCCACTC

GGGGAAATGGGTGTCTACCCAGGGAAAAGTGCCTACCCCAGTCACGGGTCAACAGTGTTGTGTTGAGGATCAAACATGGCTCTGTGAAAATACTGCCACC

CATTCTATTGGTTGGATTTCTCAGGAGTCTGAATCTTCCCTCACGAGTCCTCTTCTCCCAACCCCTACCCAGAGCCAACACTGGGATTTGAACCTTCTCT

GACTCTCTTCTTCCCTCAGGTCTGACAACTAATGGTCTCTGGGGACACCCAGCTAGGGCCTTCCCCAACTCCTTATCCAGCTGAACTTGGATTCTTCCCA

ACCAGGGCTTGACCTGGGTGCTGTTGGTCCCACTGGCCAACAACACATCTTTGGCCAGATTGGGATTCTCAATAGATTTTATAGACATTATTCTCCCACA

GACTTTAAAACATGGCTTGTGTCTTTCCATACACATCCGGTCAGATTTAAAACTATTTTATAACCACAGGAATTAAACCAAGCAAATAGAGTACTTTCAG

ATATAAACTGTGTTTCATACTTTATGTAGAGTGTGCTATGTATAGGCGGTATGTACCCTGGCTGAAGTAATATTAACCATAGCTCTGGGAGGATTTACAG

ACCTTTTGCACTTTATGCTTTTTTGTGAACTCTGATAACCATGGTCAATATTAAAGCCAATAACTGGCATTTTCTGTGAATAAACATGCATATGTATCT
Translation
MGAPHWWDHLRAGSSEVDWCEDNYTIVPAIAEFYNT ISNVLFFILPPICMCLFRQYATCFNSGIYLIWTLLVVVG - UNI33583 - GIGSVYFHAT

LSFLGQMLDELAILWVLMCALAMWFPRRYLPKIFRNDR RGRFKAVVCVLSAITTCLAFIKPAINNISLMILGLPCTALLVAELKR - UNI30876 - 

RCDNVRVFKLGLFSGLWWTLALFCWISDQAFCELLSSFHFPYLHCVW - UNI30993 - WHILICLASYLGCVCFAYFDAASEIPEQGPVIRFWPSEK

WAFIGVPYVSLLCAHKKSPVKIT

For any suggestions or comments, please send an email to unitrap@crg.es