Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038014 (BC010304)
Chromosomal location
Chr 13: 48974585 - 49063386 (-)
Description
family with sequence similarity 120, member A Gene [Source:MGI Symbol;Acc:MGI:2446163]
RefSeq_peptide
NP_001028440.2 
UniGene
Mm.25018 Mm.328058 Mm.475104 
MGI
MGI:2446163 
Uniprot/SPTREMBL
A0PJK6 B3DFJ0 Q3V3S0 Q6A0A9 Q7TMZ0 Q91Z16 
Human Ortholog
ENSG00000048828 (FAM120A)
Omim not available
UniTrap UNI8647
Vector Insertion
Chr 13: 49044673 - 49062723
Public Clones XC249 (baygenomics) RRK178 (baygenomics) XC705 (baygenomics) M122E10 (ggtc)
W182C05 (ggtc) IST14395H6 (tigm)
Private Clones OST423217 (lexicon) OST331974 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26349
Vector Insertion
Chr 13: 49041394 - 49044425
Public Clones not available
Private Clones OST123911 (lexicon) OST41694 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2185
Vector Insertion
Chr 13: 48993144 - 48997426
Public Clones XS0253 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23079
Vector Insertion
Chr 13: 48976465 - 48980641
Public Clones not available
Private Clones OST277275 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060805
Sequence
CCTCCCCAGACATGGCCCTGGGAGGCGGCAGCACATGGCGGCCGCGGCGGCCGTGAGCGCGCCCCCGGCCAGCCCCAGCCAGCCCTGAGGCTGCCCGCGC

CCGCCGGCCGCGCCACGGCCCTGCCGCCCCCAGCCCCGCCGCCGCCGGCCCCGCCGCCGCCCGCGCGCGCGCGCCCCGCCGCCGCCGCCATGGGCGTGCA

GGGCTTCCAGGACTACATCGAGAAGCACTGTCCGAGCGCCGTGGTGCCGGTGGAGCTGCAGAAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAG

CGGCCCCCGCAGACCCCGCTGCGCCTGCTGGTGGATGCCGACAACTGCCTGCATCGCCTGTACGGTGGCTTCTACACCGACTGGGTGAGCGGCGGCCAGT

GGAACCACATGCTCGGCTACCTGGCGGCTCTGGCCAAGGCCTGCTTCGGAGGCAACATCGAGCTCTTCGTCTTCTTCAATGGCGCGCTCGAGAAGGCCCG

GCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCAGACAGCGCAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACGCCACCGCCCAAGGTCTGG

TTCCTGCCTCCGGTCTGTATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAG - UNI8647 - GTTGCACAGAGCATTGAGGATCAT

CATCAAGAAGTGATTGGCTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTGGCATATGACTCCGATTATGCACTGTGCAACATCCCCTACTACTTCAGTG

CCCATGCCCTGAAACTGAGCCGCAACGGGAAGAGTCTCACCACAAGCCAGTATCTGATGCACGAGGTTGCCAAGCAACTGGACCTGAACCCAAATCGTTT

TCCTATTTTTGCTGCTCTGTTAG - UNI26349 - GAAATCACATACTACCTGATGAGGATCTGGCTTCCTTCCATTGGAGTTTACTTGGTCCAGAGC

ATCCACTCGCCTCACTGAAG GTCCGAGCCCACCAGCTGGTCTTGCCACCCTGTGATGTAGTGATCAAAGCCGTAGCTGATTATGTTCGCAACATTCATG

ACACGTCTGACCTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAG TCAAGAACAGATGACAAAGTCATTCGGTTTAAGAGAGCAGTTGGATATT

ATTCAGCAACTAGCAAGCCCATGCCATTTCACCCACCACATTACTTAG CCCGACCAAATCCATTTGGAATGCCTGGGATGGTGCCACCATATGTTCCCC

CTCAGATGCTCAACATTCCACAGACTTCTCTGCAAGCAAAGCCCGCG GTCCCGCAGGTGCCCAGCCCAGGGGGCACCCCAGGCCAGGCTCCATACCCAT

ACAGCCTCTCTGAGCCAGCCCTCACCCTGGACACTAGCGGGAAGAACCTGACAGAGCAGAATAGCTACAGCAACATTCCTCATGAGGGGAAGCACACACC

GCTGTATGAGCGCTCCTCGCCCATCAACCTGGCCCAGAGTGGCAGCCCCAATCACGTGGATTCTGCCTACTTCCCTGGCTCTTCTACATCATCATCATCA

GACAATGATGAGGGCGGCGGAGGGGCGACCAA CCACATCAGCGGGAACAAGATTGGCTGGGAGAAGACAGGAAGCCATGCAGAGCCACTGGCACGGGGA

GACCCAGGAGACCAAGTAAAG GTAGAAGGCTCATCCACTGCCTCTTCGGGGAGCCAGCTAGCTGAAGGCAAAGGGAGCCATATGGGCACTGTTCAACCA

ATCCCGTGCCTCCTGTCAATGCCAACTAGGAACCACATGGATATCACCACACCTCCATTGCCCCCTGTCGCACCTGAGGTGTTGAGAGTGGCTGAGCACA

GACACAAGAAGGGACTGATGTACCCCTACATCTTCCATATCCTGACAAAG GGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAAGACC

TGCCTCCGGCCGCCCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTT

TAGAAAGAACAGACTTCCACCAGAAT TCTCGCCACTGATCATTAAGGAGTGGGCAGCTTACAAGGGGAAATCTCCTCAGACCCCGGAACTAGTGGAAGC

ATTGGCCTTCCGGGAGTGGACCTGCCCCAACCTGAAGAGGCTTTGGCTGGGCAAGGCGGTGGAGGACAAGAACCGCCGGATGAGGGCCTTCCTGGCCTGC

ATGAGGTCTGATACCCCAGCCATGCTCAACCCTGCCAATGTGCCCACTCACCTCATGGTGCTCTGCTGCGTCTTACG - UNI2185 - GTATATGGTG

CAGTGGCCTGGAGCTCGCATTCTGCGAAGGCAGGAGCTGGATGCCTTCCTGGCTCAGGCATTGTCCCCCAAACTCTATGAGCCGGACCAGCTGCAGGAAC

TCAAG ATTGACAACTTAGACCCGAGAGGAATTCAGCTGTCGGCTCTCTTCATGAGTGGAGTAGACATGGCACTGTTTGCTAATGACGCATGTGGACAGC

CCATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTCGATGGGAAGCTCTTCCAGTCCAAACTTCTTAAAGCCAGCAGGGAGAAGACCCCACTCATCGA

CCTCTGTGATGGTCAG GCGGAGCAGGCTGCCAAGGTGGAGAAGATGCGCCAGAGCATCCTGGAGGGCCTCAGCTTCTCCCGGCAAAACCACCCACTGCC

CTTCCCACCGCCTCCTGCTCTGCCCTTCTACCCAGCCTCTGTATACCCTCGGCACTTTGGGCCAGTCCCACCCTCACAGGGCAGGGGCAGGGGCTTTGCA

G GAGTCTGTGGCTTCGGAGGCCATTATGGGGAAACAGTAGCAACAGGCCCTTACCGTGCCTTCCGGGTGACGGCAGCATCAGGACACTGTGGAGCCTTC

TCAGGCAGTGACAGCAGCAGGACTAGCAAGTCCCAGGGCG GAGTCCAACCTATTCCTTCTCAGGGAGGGAAGCTAGAAATAGCTGGCACTGTGGTCGGC

CACTGGGCTGGGAGCAGACGGGGCCGTGGGGGCCGAGGGCCCTTCCCTCTGCAGGTGGTGTCTGTGGGAGGACCAGCGCGAGG GCGTCCAAGGGGTGTT

ATTTCCACTCCGGTGATTAGAACGTTTGGAAGAGGTGGAAGGTACTACGGCAGAGGCTACAAAAGCCAGGGAGCAATTCAG - UNI23079 - GGCAG

GCCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTGAAGTCGAAATCTGGGGAATCCAAGTCCTCTGCTGTGTCCCTGGCTGAAAACGGAGTG

ATGGCCGAGGAGAAGCCAGTGCCCCAACTTAATGGGAGCACGGGTGACCCCAGAGTCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAACCGT

GCAATACAAATCCTCACTTAAATGCACTAAGTACAGACAGCGCCTGCCGCAGGGAGGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTA

TTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTCAGGAGCATCTGGAGAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAA

ATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATCAGAGATATAAACAACACATTTTTTTTTTTTTTTTTAGTTTTAACCAGTTGTAGTCAAAATGCT

ACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTTGACTCCCGCACTTAAAAATGAAGTACACAAAGTTTAAACTGGTTACGACAAAAGCCTAGAG

TTGTGTTTCTTGAACTATAAAGAAAACAAATTTTGGCAGTGTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCACT

ATATTTGATTTTGCATTACTGTTTCACAATGAAGCTGTGTTTTGAGGCTTTGATTTATGATTATGAGAGAAGTAAGGCACAACCACAGTTTCTTTCTTAC

TTAAATCTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAGTGCAACTATCAAAACTAAAAAAATTATAGATTAAACTGCTGTTGTGCTGATTTTG

AATACACAGTACATCATACATCCTTTACAAGCAAGTTCAATGGAGATTACGTTGAAATCATAGAAGATGCAAATGACCTTTCAAAGTCAACACAATGTGT

TCTGAAACCTCGTGACTAATACCATGCATCTGTGATCAGTGAGCTACGTGGTTTTGAATCGGACGTAGACCATTAGTGCTACTACTTGAGCTAATCTTCT

GCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATTATGCATGTTATTGTCCTTTCTTCCATTCTTACCAGTATGTGCCCATTTGCAAAACAAAATGCT

AATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCAT

TTATTCTAAACCCCCCAAAATTATCTAGCCGTTTGGAATATCAACATTACCCTGGTGTACTCACTGCTGTGTGCATTATTGTTCTTTGTTGCTGTTTTAT

GCCTTCATATTCATATTAGCAAAATATGAAATTCTGTAAAGAAAGAAACCCCCTATGATCTTAAAAAACAAAACACCCCCTTCCCCTTCTGTAGCAGGAA

ACAAATTGCTTGTTCTTGAGAAGTGTCCCATCAGGAACTTAGTAGAAGCAGGTAGACTTCGATCATTTTGATGTTTTGTTACTGTTTCCAAACAATGTAC

TTTGAATCAGAATCACTTCTTATGTTTCATCTACTTCCGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAACTCCCCAGCCCCTGCCCGCAAG

AGCTAAGTAGGACCTCACTGTAAGTTGAAGGGAGTTCCGCCCTAACTCATGGATTGTGAAGAATGAACTGCTGTTGGGTCTGATTGACTGTTGATGGATT

GTGGTGTGGTTTATCCAGAGGCTATTGAATGCAACTTACAATGCTTAATAAAAATCTTTATTCTTTTAGTATAAA
Translation
PPQTWPWEAAAHGGRGGRERAPGQPQPALRLPAPAGRATALPPPAPPPPAPPPPARARPAAAAMGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQ

RPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVW

FLPPVCMAHCIRLALIRFHVK - UNI8647 - VAQSIEDHHQEVIGFCRENGFHGLVAYDSDYALCNIPYYFSAHALKLSRNGKSLTTSQYLMHEVAK

QLDLNPNRFPIFAALLG - UNI26349 - GNHILPDEDLASFHWSLLGPEHPLASLK VRAHQLVLPPCDVVIKAVADYVRNIHDTSDLDAIAKDVFQ

HSQ SRTDDKVIRFKRAVGYYSATSKPMPFHPPHYLA ARPNPFGMPGMVPPYVPPQMLNIPQTSLQAKPA VPQVPSPGGTPGQAPYPYSLSEPALTLD

TSGKNLTEQNSYSNIPHEGKHTPLYERSSPINLAQSGSPNHVDSAYFPGSSTSSSSDNDEGGGGATN NHISGNKIGWEKTGSHAEPLARGDPGDQVK V

EGSSTASSGSQLAEGKGSHMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHILTK GEIKIAVSIEDEANKDLPPAALLY

RPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEF FSPLIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTP

AMLNPANVPTHLMVLCCVLR - UNI2185 - RYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELK IDNLDPRGIQLSALFMSGVDMALFAND

ACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQ AEQAAKVEKMRQSILEGLSFSRQNHPLPFPPPPALPFYPASVYPRHFGPVPPSQGR

GRGFAG GVCGFGGHYGETVATGPYRAFRVTAASGHCGAFSGSDSSRTSKSQGG GVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGP

ARG GRPRGVISTPVIRTFGRGGRYYGRGYKSQGAIQ - UNI23079 - GRPPYAASAEEVAKELKSKSGESKSSAVSLAENGVMAEEKPVPQLNGST

GDPRVPSHSESALNNDSKPCNTNPHLNALSTDSACRREAALEAAVLNKEE

For any suggestions or comments, please send an email to unitrap@crg.es