Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038047 (6230416J20Rik)
Chromosomal location
Chr 4: 86227193 - 86257928 (-)
Description
RIKEN cDNA 6230416J20 gene Gene [Source:MGI Symbol;Acc:MGI:1923389]
RefSeq_dna
NM_173400 
RefSeq_peptide
NP_775576.2 
MGI
MGI:1923389 
Uniprot/SPTREMBL
B1AXR2 Q69ZG0 Q6NV99 Q6P252 Q8BP50 Q8BQC6 Q8CA01 Q8CB73 
Human Ortholog
ENSG00000147874 (FAM29A)
Omim not available
UniTrap UNI37688
Vector Insertion
Chr 4: 86251540 - 86253895
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15199
Vector Insertion
Chr 4: 86228784 - 86231368
Public Clones PST9971-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102816
Sequence
GTCTTGGTTTGCGTGGAGCGCTGCAGTCACTGTCTGTTTTTCTGGGCGCGTTCGGCCTTTTGTGGTGGGATGGCTCTCGGAGAGGAGGCAGCGGGCGGCC

GCCGCAGAGGGGTTGTCGTCACCCCGGGATGCCTGTAGGAGGGGTCCAAGGGTCCTCACGGCTTCGGTGCCTTCGTTTTCCTCCGTCACAGTCGCCCTGC

CCGTGGAAAGCATGAGCTCGGCCCGGGACTCCGCTTTCGAGAAGCAGCATCTCTGGATGTACCTGCAGGCGCTGGGCTTGGATCCGAGCTCCAGCATCAC

GTTCGGCGGGAAGATGGTGCCGCACGCGCACCTTGGAGA AGATTGCTGGCCTCCATTTGACCAAAAACTTGACATGGAATTCCGGAAACATTGCTGTGA

ATGGTTAAAAGAGATTTCT GCTGAATGTGGGAGTAGTTTTCCTCAAGTTGTTGGCTCATTGCTTATGTCTCCTGGTGGCCCTAAGTTTATTCATCTGAT

GTATCATTTTGCAAGATATGTTGCAATCAAATATATTAAAACAAAATCTAACA ATTCTCTACATTTTGCAGAAACATTTAATGTAAAGCCACAAGATAT

GCACAAGTGCCTTGCCAGAAGCCATGTAGCACGTAACAGATTTTTACAGATTTTGCAAAGAGAACATTATGTTATGCAAAAATACCAGGAAAATGTAAA 

TCTGTCTGTTAAGCAAGTACGAAATGCAAGATCAGAGTGCATGAGTCTACAGAACCAAATT
Translation
MSSARDSAFEKQHLWMYLQALGLDPSSSITFGGKMVPHAHLGE EDCWPPFDQKLDMEFRKHCCEWLKEIS   
Transcript ENSMUST00000070607
Sequence
CTTGGTTTGCGTGGAGCGCTGCAGTCACTGTCTGTTTTTCTGGGCGCGTTCGGCCTTTTGTGGTGGGATGGCTCTCGGAGAGGAGGCAGCGGGCGGCCGC

CGCAGAGGGGTTGTCGTCACCCCGGGATGCCTGTAGGAGGGGTCCAAGGGTCCTCACGGCTTCGGTGCCTTCGTTTTCCTCCGTCACAGTCGCCCTGCCC

GTGGAAAGCATGAGCTCGGCCCGGGACTCCGCTTTCGAGAAGCAGCATCTCTGGATGTACCTGCAGGCGCTGGGCTTGGATCCGAGCTCCAGCATCACGT

TCGGCGGGAAGATGGTGCCGCACGCGCACCTTGGAGA GAATATGTTTGACAAACTGAACCGTGATGCCTTTCATATAGTTTCTTATTTTTTGTTTAAAA

CATTGGATGAGGCTCTTGCCAAAGAAGTTTTCAG AGATTGCTGGCCTCCATTTGACCAAAAACTTGACATGGAATTCCGGAAACATTGCTGTGAATGGT

TAAAAGAGATTTCT GCTGAATGTGGGAGTAGTTTTCCTCAAGTTGTTGGCTCATTGCTTATGTCTCCTGGTGGCCCTAAGTTTATTCATCTGATGTATC

ATTTTGCAAGATATGTTGCAATCAAATATATTAAAACAAAATCTAACA ATTCTCTACATTTTGCAGAAACATTTAATGTAAAGCCACAAGATATGCACA

AGTGCCTTGCCAGAAGCCATGTAGCACGTAACAGATTTTTACAGATTTTGCAAAGAGAACATTATGTTATGCAAAAATACCAGGAAAATGTAAA TCTGT

CTGTTAAGCAAGTACGAAATGCAAGATCAGAGTGCATGAGTCTACAGAACCAAATTAAAAG AATGGAGCCATATGATGAGAAGAGTAATACACAAGAGA

AGATTCAAAAG GTTCGGTCCTTGTGGGCTTCAGTGAATGAGACACTCATGGTTGTGGAAAAGGAGAGAGACGTTATTAGTTCACTCTTTGGCTTTGTCA

ACCAGTATGCTTTGGATGGAGCTCATGTTGCTGTTAATATTCCAAGGCTCTTACTTGACAGACTTGAGGAGCAGATATGTCGG TTGCAGATAGGAAATG

TTTATGAGGCTGGAAAATTGAACCTCTTAACAATTATTCACTTGTTAAATGAAGTCTTGAAAATAATGAAATATGAACATTGTAAGGCTGGCCAAGCAGG

ATTGACAATAAATCTCCACTACCTTGAAAAAGAAACCAAATTTCAGAGGGAAAGATTATCACATATGAAGCATATGAG GCATAAAGTAAAAGAGACCGT

CACTGCAGTGAGACAGTCTATTGCTGACAAGGAGGGAAAGTGGCATATGAAGTGGAAAGGCTTTCTTGGCCTGTCTCCTTTCAGACTAATTAAAGACAGA

CCTGCA GCTGTGGATCTTTTGCCTCCCATGTCTCCTCTTACGTTTGATCCTGTGTCAGAGGAAGTATATGCAAAGAGTATACTTTTTAAGTATCCTGCT

TCACTTCCAG ATTCACATAAAGAACCTAAACAAGAAAGTGGTAGCAGAAGAGAAGTGGATACCCCAGGAAGTGTGTGTGATGGAGCTAACAG CCCTGT

GCCTTTTCCCTTACAGTGTGCCGCGTCCTCAGATACAAACAGTTCCACACTCCTTGAGAAG GATCCAAATATGAGGACTCCCATAGAGAAAACCTTGAC

ATATAAGACAATAGCAGACTCTGAAGAGGAAGACTCTCCTCTATCAGATACTGCAAAGAATTCACAAAGTAGTGTTTCCAGAGGGACTCTGCCGGTGAAG

AGGAGTGAGCCATTCCAGAAAGAGCAAGCCCGTCTGGTAGATGAG - UNI15199 - GTTGCCAGAGTAGTTCTGTCTGATTCCCCACAGCTCTCTGA

GAGAAAAGAAGTTGAATTGGAGGAGCTGATTGACACTTTAATTTCTAATCCCTTCTTAACCAGGAAGCAAATTCCCCGGACTCCAGAGAACTTGA - UN

I15199 - TAACTGATATTAGGAGCTCATGGAGAAAAGCTGTTGAAACTGAAGATAACAGAAGTTCAGATGGGATTCTAGTGGATGCCAGTGCTAGAGA

AGTGTCGTCAGAGTCTTCATCTACACTGCATAATCAGAGGGAATTTAGCCTGGCTATTTTTTCCCCAGATTTTGATCGGTCTTATTTTCCTGAAGAGAAA

GCTGTCTCAGATCAGCTTAAAGGTTTACCTCAGAAACATCTGGTAACAAGTCAGATCAGAGAACCCCCAACAGAAGATGTGTCAGACTTGGTAAATAAGA

AAATGATTTGGAAGCAAGATTTAGAATGTGCAACCACCAGGCTTTCAGAAACTAGTCACATGGATGTATTCTCCCCTGTTGTGGGCAGTGGAATAGATGT

GATGAGTAGAAGTAAAGAGGACTGTGTTCCAGTACCGCCGGACCACTCACAAGCTTCTTGCATTGAGCCTTCCACACATAAAACTCTGTTATGGGATTCT

TTTCAGAGGTTGAGTGGTATTGGTATATTACATGAAACTCTTCCAGAAGTTGGTCGCCTAAGTCTTAATAGTTCTACTAGTTCAGAGACTAGTTTTAATC

TGGAACCAAAGAGTTATGTGCACAGTGATGCTTTTGCAGATGATGTGGGAAAAGGACAAGCTATTCCAGAATTAGATTCTAATTTACAGGCTCGTCTCAC

TAGTTATGAGGCTCTGAAGAAATCTCTTAGCAAAATCAGGGAAGAATCTTACCTGTCTAATCCCAAGACACTTGAACAACACAAAGTAGAACTGAGCCCT

GTAGCCAAAGCTGTGCAAGCAGATGATGCACACACTGTTTGGGACACTCAGGATTTGTTTATTGACTACGCAAAGCCATCTTCCCTCGTGCCACTTGATG

GAAAAACACAGACTGTATCACTAACTAAAGCTTTTCTGGTGGAGCAAAAATTGAAGACCACAGTACCATGTAGCCTTGGAGAATTTCTGCCTAGTTTAAA

AG - UNI15199 - AAGAAGAAATCTCAAGTAAGAGCCTTGAAGCAAGAGACTCTCTGATTTGACAAGATGAAGCATTTTCAAGTTGATTTAGCTGTG

ATGCACTTACCCTGAAGTCTTGTCACTGAACTGCAGCTGATATCATACATTGGAAGTGAATTCTTTTGTCAGCATCAAAGGAGTTCAGAATGTACTTGGC

TTCTTATAAGTGTTTAGGTCTTTTTTTTTTTTTTTGGTAAATGTTATGAGTTTGAAATATGAAGTATTTAAGAACAGAAAATGTCAAATTTTAGAAAACA

ATTTTGATTCCTAGAATAATCTTATAAGTGAATGACAAATATCATAGTTATGTTAAAAATATCTGTCGTTAACATGAGTTAGTGCCTAACCTAATGGCCA

CTGAATAACTGCATCTTTCATTTTAGAGAAATAAACCATTTTATTGGATCTTAATGGAATATTCTGGTAATAACACAAAGTGTAGTACCTTTACCTTTGG

ATGGATATTTAGTCAAAGCAGCACACCTTAGATTGTAAGCAGGCTTAATGAATTCTAAGTCTATTGGTCCTGCAGAGTGATGTTGATGGGATAAAATGCA

TGTGGTTGGTGAAGAAGATTGGAGAAACTGACGAAAATGGGTAAATAGAGATGGGCAGACCTTTAAAGAACACTGTCAAACTCTGTGTACTTTAGACTGA

GAATTTAATTCTATTTATATTTAACAAGAATATAAATGCAAAATTT
Translation
MSSARDSAFEKQHLWMYLQALGLDPSSSITFGGKMVPHAHLGE ENMFDKLNRDAFHIVSYFLFKTLDEALAKEVFR RDCWPPFDQKLDMEFRKHCCEW

LKEIS AECGSSFPQVVGSLLMSPGGPKFIHLMYHFARYVAIKYIKTKSNN NSLHFAETFNVKPQDMHKCLARSHVARNRFLQILQREHYVMQKYQENV

N NLSVKQVRNARSECMSLQNQIKR RMEPYDEKSNTQEKIQK VRSLWASVNETLMVVEKERDVISSLFGFVNQYALDGAHVAVNIPRLLLDRLEEQIC

R LQIGNVYEAGKLNLLTIIHLLNEVLKIMKYEHCKAGQAGLTINLHYLEKETKFQRERLSHMKHMR RHKVKETVTAVRQSIADKEGKWHMKWKGFLGL

SPFRLIKDRPA AVDLLPPMSPLTFDPVSEEVYAKSILFKYPASLPD DSHKEPKQESGSRREVDTPGSVCDGANS SPVPFPLQCAASSDTNSSTLLEK

 DPNMRTPIEKTLTYKTIADSEEEDSPLSDTAKNSQSSVSRGTLPVKRSEPFQKEQARLVDE - UNI15199 - VARVVLSDSPQLSERKEVELEELI

DTLISNPFLTRKQIPRTPENLI - UNI15199 - ITDIRSSWRKAVETEDNRSSDGILVDASAREVSSESSSTLHNQREFSLAIFSPDFDRSYFPEEK

AVSDQLKGLPQKHLVTSQIREPPTEDVSDLVNKKMIWKQDLECATTRLSETSHMDVFSPVVGSGIDVMSRSKEDCVPVPPDHSQASCIEPSTHKTLLWDS

FQRLSGIGILHETLPEVGRLSLNSSTSSETSFNLEPKSYVHSDAFADDVGKGQAIPELDSNLQARLTSYEALKKSLSKIREESYLSNPKTLEQHKVELSP

VAKAVQADDAHTVWDTQDLFIDYAKPSSLVPLDGKTQTVSLTKAFLVEQKLKTTVPCSLGEFLPSLKE - UNI15199 - EEEISSKSLEARDSLI

For any suggestions or comments, please send an email to unitrap@crg.es