Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038060 (Dlec1)
Chromosomal location
Chr 9: 119011627 - 119043810 (+)
Description
deleted in lung and esophageal cancer 1 Gene [Source:MGI Symbol;Acc:MGI:2443671]
MGI
MGI:2443671 
Uniprot/SWISSPROT
Q8BLA1 
Human Ortholog
ENSG00000008226 (DLEC1)
Omim 133239 - ESOPHAGEAL CANCER  211980 - LUNG CANCER  
UniTrap UNI18966
Vector Insertion
Chr 9: 119019330 - 119021174
Public Clones not available
Private Clones OST408563 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055775
Sequence
GTTGCCATGGATTCCGAGAGCAAGGAAGAGCAGCAATGCACAGCTTCCTCGGCCGTTATGTCGTCCTTGGAGACCCAGTTTTTGTCTGTCCCACACCAGC

TCGAGTCCGCCAGTCTCAGCTGGTCCATCAGGAAGTCCTTGCATTCCTCGACCGTCTTAATGGATGATTGCCATTTCGGCTTCCCTACGCGGTCCCTCCG

CGCCGGGTTCCACGCGCTCCCTCCACTCCCGGAGCCGCAGACGCTGCGTCTACGCCCCGCCTCGTTGCGCACGCAGGAAATCTCACATCTGCTTGCCCGA

GTCTTCCGAAACTTGTACACCGCCCAGGTGATCGGAGATGACTTGAGCGACAGTTTGATCAAGGCCCGCGGCAGTGAGGATGCGCGCCACGAAGAGTTCC

TTGACCAGCTGCAGCAG GCGCGAGCCATCTATAAACAGCGTCTGGATGAAGCCGCCATGTTGGAGAGACATATCATGCAGGCCCGTGCACGGGATATTG

CAGAAACAGAACACACCACCAAACAGAGCAGACTACAGGTTGTGGAGACCCCTGTCAAACTGCCCCCAG TGAAGACAGCCTTCAGGTGGTGTCTAGACA

GCAAGTTAATGCGAAAACATCACTTAATCTCTACAGAGGATTACTACACTGATCCCGTGCCGTTTTGCCCAGCACCCAAAG - UNI18966 - ACAAA

TCCACCCTTGGATGTTCAAAGCTGACGTTTAGCTGTGAGCAGCGTTTCCTGCGCAAGTCAGAGCTGGACAGGGAGGCTGAGGAGCACTGCAGGCAGCTCA

CAGAGTGTGACGACTTTGAGTACACCGTGGACAGCTTGGGCTCCATCTCGAAGGCCAAAGAGAGGACCACAGATTCTGTCAAG AAGACAAGCAGGCCAA

AGAATAAGAAGTGGATGGAACACCTGCAGGTGCCGCAGAGAGCCCTGGACAGGCGGCTGCTCGCCAGCATGGAGAACAGGAATCACTTCCTGAAAAACCC

TCGGTTTTTCCCGCCTAACACACCACATGGAGGCAAGTCTCTCATCGTCCCTTTGAGCAAGCCAGAGAGAAGAGCATCCCTGAATGCAGAGCCTGAGTGG

AG CTGTACAGATGCCCCCGTGTTCCTGGCGAAGCCATCAGTTGGATTTTTCACAGATTACGAAATTGGACCCGTTTACGAG ATGGTGATCGCTCTACA

GAACACCACCTCCACCAGCCGATTCTTGCGTGTCCTCCCACCGTCCTCTCCGTACTTCGCTCTGGGACTTG GGATGTTCCCAGGAAAAGGCGGAATAGT

GGCTCCCGGGATGACCTGCCAGTACATCGTCCAGTTCATCCCGGACTGTCTTGGCGATTTTGATGATTTCATTTTGGTGGAGACACAGTCTCCCCACACG

CTGGTAATCCCCCTGCAGGCCCGGAGACCGCCGCCAGTGCTGACCT TGTCACCAGTGTTGGACTGCGGCCACTGCCTCATTGGAGGGGTGAAGATAACC

AAATTCATCTGCAAAAATGTGGGCTTCAGCGTCGGCAAATTCTGTATCATGCCCCAAAAGAGCTGGCCGCCACCGAGTTTCCGG GCTGTTGCAACTACT

GGCTTTGTAGAGCAGCCTCCTTTTGGAGTAATGCCTTCCGTGTTTGAGCTGGCCCCAGGGTACGCCATACTGTTGGAG GTCTTGTTCCTCCCTACTGGC

CTAGGACAGGCAGAAGAGACCTTCATCATCGTGTGTGACAACTGTCAGATAAAGGAGGTGGTCGTCGTAG GGACAGGGCAGCTGGTGGCTTTGGATCTG

ATTCATATTTCTGGTGGAAAAAATGAGCCAGACCCAGGAGAGCTGAAAGATTTAACAGCCCAGTACTTTATCCGGTTTGAGCCTGAAAACGTCCAGTCCA

CCGCAAAGAAGCAGCTCATCATCAGAAATGCTAC CTCAAGTGTTTCCACAGTGTACTGCAAATGGTTCTAGAAGCTGTGCCCGAGCCCTTGAG CTCAG

GGTTGGAGAACCTGGGGGACTACTCCTACTCAGTGGATGACATGATCGTCCTGGAAATCGAGGTGAAAGGCTTGGCGGAACCCTTCCAGGTCCTTTTAGA

GCCGTACGCCCTCATCATCCCTGGGGAGAACTACATTGGCATCACCGTGAAGAAAGATTTTAAG ATGTGGAACAACAGCAAGTCACCCATCAGATACAT

GTGGGGGAAGATCAGCCACTGCCATATCATCGAAGTGGAGCCCTGCACTGGGGTGATAG AGCCCAATGAGGTCGGAGATTTTGAGTTAAACCTAACGGG

TGGGGTGCCTGGCCCAACCAGCCAGGACCTGGAGTGTGAAATCAAAGACTCACCATGCCCGGTGGTACTCCACATTGAGGCCTCATTTAAG GGACCTGC

CTTGACCATTGATGTCCCAGCCCTTCAGTTTGGTCTGCTTCGCCTGGGAAAGAAGGCTTCCATCTCCATCCAGATCCGGAATGTCAGCCAGCTGTCCGCC

GTGTGGCATTTGAAGGAGAGCCCAGTCTGCCTGGCAGAGAGAGATGAGGAT CTACCTTCCCGTGTACGCTGAGGTGCAGCAGCCTCACGTGTACCTGAA

GAACAGCCACTTGGAGTTCAGCAACCTCTACCTGGGCGTGTCCACAAAGTCAAGGACCACGCTGGTCAATGGCACACTCCTGCCCACCCGGTTCCACTGG

GGAAAGGTGACCGAGATGTGTGCAGCCCCGCCCTCTGAATGGCCATCTTCCAGAATAAACGTTCAGCCTCCCTCCC
Translation
MDSESKEEQQCTASSAVMSSLETQFLSVPHQLESASLSWSIRKSLHSSTVLMDDCHFGFPTRSLRAGFHALPPLPEPQTLRLRPASLRTQEISHLLARVF

RNLYTAQVIGDDLSDSLIKARGSEDARHEEFLDQLQQ ARAIYKQRLDEAAMLERHIMQARARDIAETEHTTKQSRLQVVETPVKLPPV VKTAFRWCLD

SKLMRKHHLISTEDYYTDPVPFCPAPKD - UNI18966 - DKSTLGCSKLTFSCEQRFLRKSELDREAEEHCRQLTECDDFEYTVDSLGSISKAKERT

TDSVK KTSRPKNKKWMEHLQVPQRALDRRLLASMENRNHFLKNPRFFPPNTPHGGKSLIVPLSKPERRASLNAEPEWS SCTDAPVFLAKPSVGFFTDY

EIGPVYE MVIALQNTTSTSRFLRVLPPSSPYFALGLG GMFPGKGGIVAPGMTCQYIVQFIPDCLGDFDDFILVETQSPHTLVIPLQARRPPPVLTL L

SPVLDCGHCLIGGVKITKFICKNVGFSVGKFCIMPQKSWPPPSFR AVATTGFVEQPPFGVMPSVFELAPGYAILLE VLFLPTGLGQAEETFIIVCDNC

QIKEVVVVG GTGQLVALDLIHISGGKNEPDPGELKDLTAQYFIRFEPENVQSTAKKQLIIRNAT TSSVSTVYCKWF     

For any suggestions or comments, please send an email to unitrap@crg.es