Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038141 (547127)
Chromosomal location
Chr 17: 6270475 - 6305783 (+)
Description
transmembrane protein 181A Gene [Source:MGI Symbol;Acc:MGI:1924356]
RefSeq_dna
NM_001033178 
RefSeq_peptide
NP_001028350.1 NP_001039003.1 
UniGene
Mm.458806 
MGI
MGI:3779544 MGI:1924356 
Uniprot/SPTREMBL
B2RVR2 Q3TM85 Q3U3W2 Q4V9W3 
Human Ortholog
ENSG00000146433 (TMEM181)
Omim not available
UniTrap UNI16893
Vector Insertion
Chr 17: 6279685 - 6280597
Public Clones not available
Private Clones OST452631 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088940
Sequence
GTTTTCCGCGCCCGGCTGCTTGGCTTCCCTGGTGGCTCCGGCGGCGGCTTCGGGACGCCGGGCGAACTCGGGACCATCCGGCGGGGGCCGGGGACCCGAG

GCTCGGAGATGGAACC - UNI16893 - GTTGGCACCCATGCGGCTCTATACGCTCTCCAAGCGCCACTTCGTCCTTGTGTTTGTTGTCTTCTTCATC

TGTTTTGGACTGACCGTCTTCGTCGGCATCGAGG GACCCAGAGTGATCGAGACTTTGCCTGCTAATTATTCACTCAATAGTAGCAAAAAG CTAAAGAC

AGTTATACCTTCAAACCCACTGTCCACATATAACCAACAACTATGGCTGATGTGCGTTGTGGAGCTGGAGCCCTCAGAAG AAACATCCATCCAAACCAG

CTTCACCATGACAGTGAAGGTCGATGGTGTGTCTCAAGATGGAACCACGACGTACATCCATAACAAGGTTCACAACCGGACGAGGACCCTCACGTGTGCA

GGG AAATGTGCAGAAATCATCGTGGCCCACCTTGGCTACCTGAATTACACACAGTACAGGGTTACTGTGGGGTTTGAGCACCTGAACCAGCCCATCAAG

GATATGAACTTCACG TGGAAGACATACAACCCTGCGTTTTCCCGGCTGGAGATCTGGTTCCACTTCGTGTTTGTGGTGCTCACCTTCATCGTGATT TG

CCTGTTTGTACATTCCCTGCGCAAGTTCTCCATGAGGGACTGGGGCATCGAGCAGAAGTGGATGTCTGTCCTCCTGGCCCTGCTGCTGCTCTACAATG A

CCCTTTCTTCCCACTCTCCTTCTTGGTGAATAGCTGGTTCCCGGGGATGCTGGACGACTTCTTCCAGTCTCTGTTCCTGTGTGCCCTGCTGCTCTTCTGG

CTGTGCGTGTATCATGGGATACGGGTCCAG GGAGAGAGAAAATGTTTAACTTTCTATTTGCCTAAGTTCTTCATCGTTGGACTGCTGTGGCTGGCTTCT

GTCACTCTGGGAATATGGCAGAC ATTTAATGAATTAAATGATCCCATGTACCAGTATCGGGTTGACACCGGAAACTTTCAG GGCATGAAGGTCTTCTT

CATGGTGGTGGCCGCTGTGTACATTTTATACCTTCTATTCTTGATAGTGCGAGCATGCTCCGAGCTCCGTCATATGCCTTACGTGG ATCTCAGGTTAAA

GTTTTTGACTGCGTTGACCTTTGTAGTGCTAGTTATTAG CATCGTCATCCTCTACCTACGGTTTGGAGCACAAGTGTTGCAGGACAACTTCGTAGCAGA

ACTGTCGGCTCACTACCAGAACT CAGCTGAATTCCTGTCTTTCTATGGCCTGTTGAACTTTTACTTGTACACGCTGGCCTTTGTGTACTCTCCGTCGAA

GAATGCCCTGTACG AGTCCCAGCTGAAGGATAACCCTGCGTTTTCCATGTTGAACGACTCTGACGATGACGTGATTTACGG GAGTGACTATGAAGAAA

TGCCCCTGCAGAACGGCCAGGCCATCCGTGCCAAGTGCAGGGAAGAGTCGGACAGTGACTGAGCCCCGGGCAGCAGATGGGACAGCAGGGGGCCAGAGGC

CTGCCTGAGTGACACATTCTGGCCCCTTCTATCTGTTTGTGTCTGGACTCCTCTGTAAGCAAAGGTTTCCTGTTCCTTATTTGTTTACATATTTTTAAAA

GAAAACCCAAATGGATTGAAATGTGGGGCGGAGTTTGCTTTGGGGGCAGCCCCACTCTTTAAGAAGAGGGGCTGCCTGGTAGAGAATTCAAAGGCATATC

CTGTACACCGACATCAGGTGCGATGGAGCCCGTATGCAGTCATGAGGAGAAGTTACCCATTTTTAATAAAAAGAATTATGTACTTTTTCTTTCCTTTT
Translation
MEP - UNI16893 - PLAPMRLYTLSKRHFVLVFVVFFICFGLTVFVGIEG GPRVIETLPANYSLNSSKK LKTVIPSNPLSTYNQQLWLMCVVELE

PSEE ETSIQTSFTMTVKVDGVSQDGTTTYIHNKVHNRTRTLTCAG KCAEIIVAHLGYLNYTQYRVTVGFEHLNQPIKDMNFT WKTYNPAFSRLEIWF

HFVFVVLTFIVI CLFVHSLRKFSMRDWGIEQKWMSVLLALLLLYND DPFFPLSFLVNSWFPGMLDDFFQSLFLCALLLFWLCVYHGIRVQ GERKCLT

FYLPKFFIVGLLWLASVTLGIWQT TFNELNDPMYQYRVDTGNFQ GMKVFFMVVAAVYILYLLFLIVRACSELRHMPYVD DLRLKFLTALTFVVLVIS

 SIVILYLRFGAQVLQDNFVAELSAHYQNS SAEFLSFYGLLNFYLYTLAFVYSPSKNALYE ESQLKDNPAFSMLNDSDDDVIYG GSDYEEMPLQNGQ

AIRAKCREESDSD
Transcript ENSMUST00000031589
Sequence
ATGGAACA - UNI16893 - GTTGGCACCCATGCGGCTCTATACGCTCTCCAAGCGCCACTTCGTCCTTGTGTTTGTTGTCTTCTTCATCTGTTTTGG

ACTGACCGTCTTCGTCGGCATCGAGG GACCCAGAGTGATCGAGACTTTGCCTGCTAATTATTCACTCAATAGTAGCAAAAAG CTAAAGACAGTTATAC

CTTCAAACCCACTGTCCACATATAACCAACAACTATGGCTGATGTGCGTTGTGGAGCTGGAGCCCTCAGAAG AAACATCCATCCAAACCAGCTTCACCA

TGACAGTGAAGGTCGATGGTGTGTCTCAAGATGGAACCACGACGTACATCCATAACAAGGTTCACAACCGGACGAGGACCCTCACGTGTGCAGGG AAAT

GTGCAGAAATCATCGTGGCCCACCTTGGCTACCTGAATTACACACAGTACAGGGTTACTGTGGGGTTTGAGCACCTGAACCAGCCCATCAAGGATATGAA

CTTCACG TGGAAGACATACAACCCTGCGTTTTCCCGGCTGGAGATCTGGTTCCACTTCGTGTTTGTGGTGCTCACCTTCATCGTGATT TGCCTGTTTG

TACATTCCCTGCGCAAGTTCTCCATGAGGGACTGGGGCATCGAGCAGAAGTGGATGTCTGTCCTCCTGGCCCTGCTGCTGCTCTACAATG ACCCTTTCT

TCCCACTCTCCTTCTTGGTGAATAGCTGGTTCCCGGGGATGCTGGACGACTTCTTCCAGTCTCTGTTCCTGTGTGCCCTGCTGCTCTTCTGGCTGTGCGT

GTATCATGGGATACGGGTCCAG GGAGAGAGAAAATGTTTAACTTTCTATTTGCCTAAGTTCTTCATCGTTGGACTGCTGTGGCTGGCTTCTGTCACTCT

GGGAATATGGCAGAC ATTTAATGAATTAAATGATCCCATGTACCAGTATCGGGTTGACACCGGAAACTTTCAG GGCATGAAGGTCTTCTTCATGGTGG

TGGCCGCTGTGTACATTTTATACCTTCTATTCTTGATAGTGCGAGCATGCTCCGAGCTCCGTCATATGCCTTACGTGG ATCTCAGGTTAAAGTTTTTGA

CTGCGTTGACCTTTGTAGTGCTAGTTATTAG CATCGTCATCCTCTACCTACGGTTTGGAGCACAAGTGTTGCAGGACAACTTCGTAGCAGAACTGTCGG

CTCACTACCAGAA ACCAGCTGAATTCCTGTCTTTCTATGGCCTGTTGAACTTTTACTTGTACACGCTGGCCTTTGTGTACTCTCCGTCGAAGAATGCCC

TGTACG AGTCCCAGCTGAAGGATAACCCTGCGTTTTCCATGTTGAACGACTCTGACGATGACGTGATTTACGG GAGTGACTATGAAGAAATGCCCCTG

CAGAACGGCCAGGCCATCCGTGCCAAGTGCAGGGAAGAGTCGGACAGTGACTGAGCCCCGGGCAGCAGATGGGACAGCAGGGGGCCAGAGGCCTGCCTGA

GTGACACATTCTGGCCCCTTCTATCTGTTTGTGTCTGGACTCCTCTGTAAGCAAAGGTTTCCTGTTCCTTATTTGTTTACATATTTTTAAAAGAAAACCC

AAATGGATTGAAATGTGGGGCGGAGTTTGCTTTGGGGGCAGCCCCACTCTTTAAGAAGAGGGGCTGCCTGGTAGAGAATTCAAAGGCATATCCTGTACAC

CGACATCAGGTGCGATGGAGCCCGTATGCAGTCATGAGGAGAAGTTACCCATTTTTAATAAAAAGAATTATGTACTTTTTCTTTCCTTTT
Translation
MEQ - UNI16893 - QLAPMRLYTLSKRHFVLVFVVFFICFGLTVFVGIEG GPRVIETLPANYSLNSSKK LKTVIPSNPLSTYNQQLWLMCVVELE

PSEE ETSIQTSFTMTVKVDGVSQDGTTTYIHNKVHNRTRTLTCAG KCAEIIVAHLGYLNYTQYRVTVGFEHLNQPIKDMNFT WKTYNPAFSRLEIWF

HFVFVVLTFIVI CLFVHSLRKFSMRDWGIEQKWMSVLLALLLLYND DPFFPLSFLVNSWFPGMLDDFFQSLFLCALLLFWLCVYHGIRVQ GERKCLT

FYLPKFFIVGLLWLASVTLGIWQT TFNELNDPMYQYRVDTGNFQ GMKVFFMVVAAVYILYLLFLIVRACSELRHMPYVD DLRLKFLTALTFVVLVIS

 SIVILYLRFGAQVLQDNFVAELSAHYQK KPAEFLSFYGLLNFYLYTLAFVYSPSKNALYE ESQLKDNPAFSMLNDSDDDVIYG GSDYEEMPLQNGQ

AIRAKCREESDSD

For any suggestions or comments, please send an email to unitrap@crg.es