Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038147 (Cd84)
Chromosomal location
Chr 1: 173770735 - 173816561 (+)
Description
CD84 antigen Gene [Source:MGI Symbol;Acc:MGI:1336885]
RefSeq_dna
NM_013489 
RefSeq_peptide
NP_038517.1 
MGI
MGI:1336885 
Uniprot/SWISSPROT
Q18PI6 
Uniprot/SPTREMBL
B2RU38 
Human Ortholog
ENSG00000066294 (CD84)
Omim not available
UniTrap UNI32606
Vector Insertion
Chr 1: 173782267 - 173802827
Public Clones (ggtc) IST10950E9 (tigm) IST12098C8 (tigm) IST11929F8 (tigm) IST10245G7 (tigm)
IST10801G12 (tigm) IST12069B4 (tigm) IST11559B4 (tigm) IST12526G6 (tigm)
IST12251A9 (tigm) IST12077E7 (tigm) IST12453E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042302
Sequence
AAAGCAGCTACCACACCAGTTATTTTTCCTCAGAAGACTGGAGTCTGACTGGACATGGCCCAGCGCCATCTGTGGATCTGGTTCCTTTGCCTACAAACCT

 GGTCTGAAGCAGCAGGAAAAGATGCAGACCCGGTGGTAATGAATGGGATTCTTGGGGAGTCAGTTACTTTCCTCTTAAATATTCAAGAACCAAAGAAAA

TTGACAACATTGCCTGGACTTCTCAATCATCTGTTGCTTTTATAAAACCAGGAGTCAATAAAGCTGAAGTTACCATAACCCAGGGCACTTATAAAGGACG

AATAGAAATCATAGATCAGAAGTATGACCTGGTCATTAGAGACCTGAGGATGGAAGATGCAGGAACTTACAAAGCAGACATCAATGAAGAGAATGAGGAA

ACCATCACCAAGATCTACTACCTTCATATCTACC - UNI32606 - GTCGACTTAAAACACCAAAAATTACACAGAGTTTGATATCATCTTTGAACAA

TACCTGTAATATCACACTGACATGCTCTGTGGAAAAGGAAGAAAAGGATGTCACATATAGCTGGAGTCCCTTTGGAGAGAAAAGCAATGTCCTTCAAATC

GTCCACTCCCCCATGGACCAAAAACTGACCTACACATGTACAGCCCAGAACCCTGTCAGCAACAGTTCTGACTCTGTCACTGTCCAGCAGCCATGTACAG

 ACACTCCAAGCTTCCATCCTCGCCATGCTGTGTTGCCAGGAGGATTGGCCGTGCTCTTTCTGCTTATTCTCATTCCGATGTTGGCATTTCTGTTCCGTT

TGTATAAGAGAAGGCGAGACAGGATTGTCCTGGAAG CAGATGATGTCTCAAAGAAAACAGTATATGCTGTAGTTTCAAGAAATGCTCAACCCACAGAGT

CCAGAATCTATGATGAAATCCCTCAGTCCAAG ATGCTGTCCTGTAAGAAAGATCCGGTGACCACCATTTATTCCTCAGTGCAGCTTTCTGAGAAG ATG

AAGGAAACCAACATGAAGGACAGAAGTCTGCCTAAGGCTTTGGGTAATGAAATTGTTGTCTAGGTGA
Translation
MAQRHLWIWFLCLQTW WSEAAGKDADPVVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLR

MEDAGTYKADINEENEETITKIYYLHIYR - UNI32606 - RRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMD

QKLTYTCTAQNPVSNSSDSVTVQQPCTD DTPSFHPRHAVLPGGLAVLFLLILIPMLAFLFRLYKRRRDRIVLEA ADDVSKKTVYAVVSRNAQPTESRI

YDEIPQSK MLSCKKDPVTTIYSSVQLSEK MKETNMKDRSLPKALGNEIVV

For any suggestions or comments, please send an email to unitrap@crg.es