Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038172 (Ttc39b)
Chromosomal location
Chr 4: 82866205 - 82970143 (-)
Description
tetratricopeptide repeat domain 39B Gene [Source:MGI Symbol;Acc:MGI:1917113]
RefSeq_dna
NM_027238 
RefSeq_peptide
NP_081514.1 
UniGene
Mm.5540 Mm.474719 
MGI
MGI:1917113 
Uniprot/SWISSPROT
Q8BYY4 
Uniprot/SPTREMBL
B2RX73 
Human Ortholog
ENSG00000155158 (TTC39B)
Omim not available
UniTrap UNI8596
Vector Insertion
Chr 4: 82943867 - 82969974
Public Clones (sanger) XB523 (baygenomics) XB482 (baygenomics) E002E04 (ggtc)
D168F11 (ggtc) 5SE287H04 (ggtc) H001B12 (ggtc) D188C10 (ggtc) D093B07 (ggtc)
E115E07 (ggtc) F033B08 (ggtc) CMHD-GT_545G2-5S (cmhd) CMHD-GT_545G2-3 (cmhd)
IST14698H9 (tigm) IST12181D9 (tigm) IST13549D8 (tigm) IST13390G9 (tigm)
IST14471F2 (tigm) IST14887D11 (tigm) IST14163C12 (tigm) IST12180F12 (tigm)
IST11715A9 (tigm) IST14234H12 (tigm) IST12515F6 (tigm) IST11259H4 (tigm)
IST10866F6 (tigm)
Private Clones OST411023 (lexicon) OST408606 (lexicon) OST361944 (lexicon) OST360574 (lexicon)
OST329689 (lexicon) OST306809 (lexicon) OST278470 (lexicon) OST269742 (lexicon)
OST246816 (lexicon) OST239693 (lexicon) OST234901 (lexicon) OST194057 (lexicon)
OST173331 (lexicon) OST149977 (lexicon) OST128595 (lexicon) OST124635 (lexicon)
OST123076 (lexicon) OST118806 (lexicon) OST102236 (lexicon) OST68430 (lexicon)
OST56178 (lexicon) OST55232 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9513
Vector Insertion
Chr 4: 82917123 - 82943831
Public Clones (sanger) RRA064 (baygenomics) XC196 (baygenomics) D143G08 (ggtc)
Private Clones OST446540 (lexicon) OST440403 (lexicon) OST404029 (lexicon) OST384610 (lexicon)
OST376003 (lexicon) OST373202 (lexicon) OST368977 (lexicon) OST356040 (lexicon)
OST354962 (lexicon) OST339812 (lexicon) OST305067 (lexicon) OST292518 (lexicon)
OST279661 (lexicon) OST262544 (lexicon) OST261056 (lexicon) OST245836 (lexicon)
OST231810 (lexicon) OST222991 (lexicon) OST218366 (lexicon) OST209663 (lexicon)
OST201313 (lexicon) OST195898 (lexicon) OST193103 (lexicon) OST189123 (lexicon)
OST170617 (lexicon) OST155173 (lexicon) OST155077 (lexicon) OST142013 (lexicon)
OST131464 (lexicon) OST114795 (lexicon) OST101079 (lexicon) OST85681 (lexicon)
OST80806 (lexicon) OST73226 (lexicon) OST64382 (lexicon) OST62822 (lexicon)
OST58080 (lexicon) OST56249 (lexicon) OST42043 (lexicon) OST34588 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19984
Vector Insertion
Chr 4: 82909706 - 82917020
Public Clones (sanger) D137A05 (ggtc) CMHD-GT_545F1-3 (cmhd) CMHD-GT_476D8-3 (cmhd)
IST13052B10 (tigm) IST12298B11 (tigm) IST13285F4 (tigm) IST11625C12 (tigm)
Private Clones OST375873 (lexicon) OST256557 (lexicon) OST248065 (lexicon) OST217238 (lexicon)
OST105050 (lexicon) OST65674 (lexicon) OST54244 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19291
Vector Insertion
Chr 4: 82907862 - 82909597
Public Clones not available
Private Clones OST396383 (lexicon) OST368859 (lexicon) OST345249 (lexicon) OST285212 (lexicon)
OST230397 (lexicon) OST213776 (lexicon) OST212141 (lexicon) OST193872 (lexicon)
OST191702 (lexicon) OST59440 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19585
Vector Insertion
Chr 4: 82906863 - 82907729
Public Clones not available
Private Clones OST388440 (lexicon) OST205199 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16509
Vector Insertion
Chr 4: 82905371 - 82906785
Public Clones (ggtc) IST11212F4 (tigm)
Private Clones OST459542 (lexicon) OST190141 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21596
Vector Insertion
Chr 4: 82902017 - 82905236
Public Clones (ggtc) IST10771F11 (tigm) IST10271A4 (tigm) IST14420F6 (tigm) IST14873A4 (tigm)
IST10219H9 (tigm) IST14325H3 (tigm) IST15055B3 (tigm) IST11668D10 (tigm)
Private Clones OST324749 (lexicon) OST324746 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37236
Vector Insertion
Chr 4: 82898955 - 82901948
Public Clones (ggtc) CMHD-GT_474F9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26782
Vector Insertion
Chr 4: 82893623 - 82898889
Public Clones not available
Private Clones OST97808 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31298
Vector Insertion
Chr 4: 82888042 - 82889868
Public Clones IST12253E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25792
Vector Insertion
Chr 4: 82887642 - 82888042
Public Clones not available
Private Clones OST166259 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7939
Vector Insertion
Chr 4: 82883255 - 82885713
Public Clones RRJ362 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34217
Vector Insertion
Chr 4: 82878614 - 82883255
Public Clones IST15109G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000030205
Sequence
GTGCTGGGCTGAACCCAGAGCCAGAAAAGAGTCGGTTCTGAGTTCCCTGTGGGTGTGCGGCCGCCGCGGAGGGGAACATGGCGCTCGTGGGCAGCCGAGT

GGAATTGGACGCGGACGAG - UNI8596 - GATATCTTTGAAGATGCCTTGGAGACCATCTCTAG - UNI9513 - ATCTCCATCGGACATGGCCA

CCAGCGGCTTTCACTTTGTACCATGCGAGACCAAACGGACCTCCAGACAGCTTGGAGCATCTGCTATGGGAAGACCTGAAGG - UNI19984 - TTCA

TCAGCCAAGGTGGATCTCAAGAGCGGCCTGGAGGAGTGTGCAGAGGCACTGAACTTATTTCTAAGTAACAAATTTAAAGATGCCCTAGAGTTGCTACGTC

CATG - UNI19291 - GGCCAAGGAGAGCATGTACCACGCCTTGGGCTACAGCACCATTGTGGTGTTGCAGGCTGTCATGACCTTCGAGCAGCAGGAC

ATCCAGAATGGCATCTCTGCCATGAAGGACGCTTTACAAACCTGCCAAAA - UNI19585 - ATACAGGAAGAAATGCACAGTTGTCGAGTCTTTCTC

AAGTCTCCTTTCTCGAGGGTCCCTGGAACAACTGAGTGAAG - UNI16509 - AAACTGATCTCCGAGCATCCCTAAGAACAAGAGCTGGTACTGGGA

GGCCTAAAGTGTTTCCGAGACAATCCATGAGACTGAACTGGCCCCAGTATGACTTGCATTGCCTTTTCCTTCCTGGGAACCCCATGTGA
Translation
MALVGSRVELDADE - UNI8596 - DIFEDALETISR - UNI9513 - RSPSDMATSGFHFVPCETKRTSRQLGASAMGRPEG - UNI19984 -

 GSSAKVDLKSGLEECAEALNLFLSNKFKDALELLRPW - UNI19291 - WAKESMYHALGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQK - 

UNI19585 - KYRKKCTVVESFSSLLSRGSLEQLSEE - UNI16509 - ETDLRASLRTRAGTGRPKVFPRQSMRLNWPQYDLHCLFLPGNPM
Transcript ENSMUST00000048274
Sequence
GGGGACAGCTCGGTCCGGTCGCTCGGGGCCGCCTGGTTCCTCCTCCACCCGTGCTGGGCTGAACCCAGAGCCAGAAAAGAGTCGGTTCTGAGTTCCCTGT

GGGTGTGCGGCCGCCGCGGAGGGGAACATGGCGCTCGTGGGCAGCCGAGTGGAATTGGACGCGGACGAG - UNI8596 - GATATCTTTGAAGATGCC

TTGGAGACCATCTCTAG - UNI9513 - ATCTCCATCGGACATGGCCACCAGCGGCTTTCACTTTGTACCATGCGAGACCAAACGGACCTCCAGACAG

CTTGGAGCATCTGCTATGGGAAGACCTGAAGG - UNI19984 - TTCATCAGCCAAGGTGGATCTCAAGAGCGGCCTGGAGGAGTGTGCAGAGGCACT

GAACTTATTTCTAAGTAACAAATTTAAAGATGCCCTAGAGTTGCTACGTCCATG - UNI19291 - GGCCAAGGAGAGCATGTACCACGCCTTGGGCT

ACAGCACCATTGTGGTGTTGCAGGCTGTCATGACCTTCGAGCAGCAGGACATCCAGAATGGCATCTCTGCCATGAAGGACGCTTTACAAACCTGCCAAAA

 - UNI19585 - ATACAGGAAGAAATGCACAGTTGTCGAGTCTTTCTCAAGTCTCCTTTCTCGAGGGTCCCTGGAACAACTGAGTGAAG - UNI165

09 - - UNI21596 - AGGAGATGCATGCTGAGATCTGTTACGCCGAGTGTCTCCTACAGAAAGCAGCACTCACATTTGTGCAG GATGAAAATATGA

TCAACTTCATCAAAGGTGGACTCAAAATTAGAACAAGTTACCAAATATATAA - UNI26782 - AGAGTGCCTTTCCATCCTGCACGTCATTCAGAAG

AACAAACAAGAGCAGCACTTCTTCTATGAGTTTGAGGGAGGAGTCAAGCTTGGAACGGGGGCCTTTAATTTG ATGCTCTCTCTTTTACCAGCAAGAATC

ATCCGGTTACTAGAATTTATTGGATTTTCTGGAAACAGG GACCTAGGCCTTCTGCAGCTCCGGGAAGGCGCATCAGGAAGCAGCATGCGGTCCCCGCTC

TGTTGCCTTACCATCCTGGCCTTCCATACCTACATCTCCCTCATTCTCG GTACAGGAGAAGTGAATGTTGTGGAAGCAGAGAGTCTCCTCGCTCCGTTC

CTTCAACAGTTCCCAAAT - UNI31298 - GGCTCCCTCATACTCTTCTATCATGCCCGAATCGAGCTGCTCAAAGGGAACACTGAAAAG - UNI31

298 - GCTCAAGAAACATTTCGAAAGTGCATTTCAGTTCAAGAAGAGTGGAAACAGTTTCACCATCTCTGTTACTGGGAATTAATGTGGATTCATATAT

ACCAACAAAATTGGATGCAGGCGTATTACTATTCAGACCTACTTTGCAAAGAGAGTAAATGGTCCAAG - UNI25792 - - UNI31298 - GCAAC

ATATGTGTTCTTGAAAGCTGCTATTTTGAGCATGCTTCCAGAGGAAGAAGTGGCAGCGACTAAGGAGAATGTGGTGTCTCTGTTTAG ACAGGTGGATGG

TCTGAAGCAGAGAATCGCGGGGAAATCTCTCCCAACAGAGAAGTTCGCTGTGAGGAAGGCGCGGAGGTACTCACCCCCGTCAGGCGTCCCCGGAAAGCTG

GTGATGCCAGCCCTGGTACTGCTTTTACTCACTGTTTACCTACCAGAGATAAGGTCACTGTTGGGAGCATCGAGGGATGCACTTACCTTTGCTTGTGAAG

TTTATAGCTCAGTTGAGAACTATTATGTATTTTTATATTTATACGTAAACTAGTTTTAAAATAAATTGAAAATTTTATCTGATGTGTTTTGACTAGTTAG

TATGTTCTAGCTATTGTGATAAAGGCAACTTCAAAAAATCATTTTGAATAAAGTGGAATTGAATTACAAAATA
Translation
MALVGSRVELDADE - UNI8596 - DIFEDALETISR - UNI9513 - RSPSDMATSGFHFVPCETKRTSRQLGASAMGRPEG - UNI19984 -

 GSSAKVDLKSGLEECAEALNLFLSNKFKDALELLRPW - UNI19291 - WAKESMYHALGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQK - 

UNI19585 - KYRKKCTVVESFSSLLSRGSLEQLSEE - UNI16509 - - UNI21596 - EEMHAEICYAECLLQKAALTFVQ DENMINFIKGG

LKIRTSYQIYK - UNI26782 - KECLSILHVIQKNKQEQHFFYEFEGGVKLGTGAFNL MLSLLPARIIRLLEFIGFSGNR DLGLLQLREGASGSS

MRSPLCCLTILAFHTYISLILG GTGEVNVVEAESLLAPFLQQFPN - UNI31298 - GSLILFYHARIELLKGNTEK - UNI31298 - AQETFR

KCISVQEEWKQFHHLCYWELMWIHIYQQNWMQAYYYSDLLCKESKWSK - UNI25792 - - UNI31298 - ATYVFLKAAILSMLPEEEVAATKEN

VVSLFR RQVDGLKQRIAGKSLPTEKFAVRKARRYSPPSGVPGKLVMPALVLLLLTVYLPEIRSLLGASRDALTFACEVYSSVENYYVFLYLYVN
Transcript ENSMUST00000102823
Sequence
GTGCTGGGCTGAACCCAGAGCCAGAAAAGAGTCGGTTCTGAGTTCCCTGTGGGTGTGCGGCCGCCGCGGAGGGGAACATGGCGCTCGTGGGCAGCCGAGT

GGAATTGGACGCGGACGAG - UNI8596 - GATATCTTTGAAGATGCCTTGGAGACCATCTCTAG - UNI9513 - ATCTCCATCGGACATGGCCA

CCAGCGGCTTTCACTTTGTACCATGCGAGACCAAACGGACCTCCAGACAGCTTGGAGCATCTGCTATGGGAAGACCTGAAGG - UNI19984 - TTCA

TCAGCCAAGGTGGATCTCAAGAGCGGCCTGGAGGAGTGTGCAGAGGCACTGAACTTATTTCTAAGTAACAAATTTAAAGATGCCCTAGAGTTGCTACGTC

CATG - UNI19291 - GGCCAAGGAGAGCATGTACCACGCCTTGGGCTACAGCACCATTGTGGTGTTGCAGGCTGTCATGACCTTCGAGCAGCAGGAC

ATCCAGAATGGCATCTCTGCCATGAAGGACGCTTTACAAACCTGCCAAAA - UNI19585 - ATACAGGAAGAAATGCACAGTTGTCGAGTCTTTCTC

AAGTCTCCTTTCTCGAGGGTCCCTGGAACAACTGAGTGAAG - UNI16509 - - UNI21596 - AGGAGATGCATGCTGAGATCTGTTACGCCGAG

TGTCTCCTACAGAAAGCAGCACTCACATTTGTGCAG GATGAAAATATGATCAACTTCATCAAAGGTGGACTCAAAATTAGAACAAGTTACCAAATATAT

AA - UNI26782 - AGAGTGCCTTTCCATCCTGCACGTCATTCAGAAGAACAAACAAGAGCAGCACTTCTTCTATGAGTTTGAGGGAGGAGTCAAGCT

TGGAACGGGGGCCTTTAATTTG ATGCTCTCTCTTTTACCAGCAAGAATCATCCGGTTACTAGAATTTATTGGATTTTCTGGAAACAGG GACCTAGGCC

TTCTGCAGCTCCGGGAAGGCGCATCAGGAAGCAGCATGCGGTCCCCGCTCTGTTGCCTTACCATCCTGGCCTTCCATACCTACATCTCCCTCATTCTCG 

GTACAGGAGAAGTGAATGTTGTGGAAGCAGAGAGTCTCCTCGCTCCGTTCCTTCAACAGTTCCCAAAT - UNI31298 - GGCTCCCTCATACTCTTC

TATCATGCCCGAATCGAGCTGCTCAAAGGGAACACTGAAAAG - UNI31298 - GCTCAAGAAACATTTCGAAAGTGCATTTCAGTTCAAGAAGAGTG

GAAACAGTTTCACCATCTCTGTTACTGGGAATTAATGTGGATTCATATATACCAACAAAATTGGATGCAGGCGTATTACTATTCAGACCTACTTTGCAAA

GAGAGTAAATGGTCCAAG - UNI25792 - - UNI31298 - GCAACATATGTGTTCTTGAAAGCTGCTATTTTGAGCATGCTTCCAGAGGAAGAAG

TGGCAGCGACTAAGGAGAATGTGGTGTCTCTGTTTAG ACAGGTGGATGGTCTGAAGCAGAGAATCGCGGGGAAATCTCTCCCAACAGAGAAGTTCGCTG

TGAGGAAGGCGCGGAGGTACTCACCCCCGTCAGGCGTCCCCGGAAAGCTGGTGATGCCAGCCCTG - UNI7939 - - UNI34217 - GAAATGATG

TACGTCTGGAATGGCTTTTCAATAGTGGGAAAAAGGAAGGACCTTTCTGAAAATCTCTTGGTGACTGTGGAGAAGGCTGAGGAGGCATTGCAGAATCAAG

 - UNI34217 - ACTTTACTGACTACTCTGTGGATGATGAATGCTTGGTGAAATTACTGAAAGGATGCTGCCTCAAGAACTTGGAGCGGCCCTTGCAA

GCTGAGCTGTGTTTCAACCACGTTGTGGAAAG - UNI34217 - TGAAAAACTATTGAAGTACGACCACTATCTGGTGCCATTTACGCTGTTTGAGTT

GGCATTTTTGTATAAAAGCCAAGGGGAAATTGACAAGGCCATCAAGGTCCTAGAAACTGCAAG AAATAACTATAAGGATTACTCCCTGGAGTCCAGGCT

ACACTTCAGAATTCAAGCAGCTCTTCATCTCTGGAAGAAACCTTCCACGGACTGATCCGGAACACACAGGATGGATCTTCCCCCCCGGTTAACATTGACT

CTTGCTATGGAGATCACTCTCTGTGTCAAGGTGGACCCATGATCCATCAAATAAGAAACAGAAAGCCTGCTGTCAGCCACTTCCTGTCATCGGAGTGGCG

TACTGTTTGGTCTACATACTTTCCCCTCTGGAATGACATTTAATACTATACAGAAATTCTTATACTCTGCCTTCACTGTAGATTTCAATTGAGGGGGTGA

AGTCTTTTAAAAGACTGGCAGGTACAATAAAGCCTAGTTAGATTATTTATTTTTTTAATGTAAAAATTAATATTGTTCAAATAGCAAATGGCTTTATCAG

CTGAGCCATTTTTAGATTGGCTTGTCCTTTAAACTTCAGAGATATTTTACTGCTGTTTAAATCTCTGAGAGTAAATAAATATCACATCTATAATAGTATG

ACAGTGGGTTTCTGAAGATTCTGGAAGAGAGAAATGAGGGGCCTGAGGTGGGTGAAGTATTCCTAGGCAGAAGGGACTTGTATCTCAGCAAGATGTCACA

GTTGTAAGTTTCAGGATTTCCAGTCCTCTCATTGGTTGAAGGTGGTGGCATTTTTCAGAAACTATCCTGTATTTGAATGTACTCATATCAGATCCAATAA

TAGCATTCAATCACATAGACACATTTCTCATGTATCTAAGGGAATAAAAAGCTGTATTTTAGATCTCCCTAAGCTTAGTGCTGAAGCCTGAACTACAGAC

TTCCATTGTGTTTCTTACAGGAAGGAGAAGCTCCTGTTGCTGTGAGTGATATGTGACATGTCAGTGATTGTTTACAGTCATGATGCTGCTGACCCAGGGC

CATGGCTGCATCTTGGTTCTCTGAGTAGGAACCCGGATCAGAGCCTGAGCAGATGCCCTTCTGGGGTCCCCACACCTGTCAATCACCCTTTGTGAATTAG

AAAGAACACGCTCATTTCGAGAAACAGAAAAGGCACAGATGGCTTTAATTTCTCTTTGAATTGTGTAACTGTGAGTCTCTGTGTTAGACACTTTCAACAA

TGCTTAGCATTAATCCAAACTCTTCCCATTAGAATATAGTTTCTTCAACCCCTCGCTCTCCTCCCAATCAACGGCCTATCAATAGTGGGTGTTACAGCTG

AGGGCCAGACTCCACCCAGTGACAAAAACCAGTTAGAGTCCATGGACCTGGGCTTTTGTCTTGTTTCTATTATTTCCAAGACCAGTAACTTCTCTAGAGG

GTAGATGGCTCCACCTTCCCTCGTCAGCGCCCCAGGTTTGTAGTTCTGAGTCTTTCTCTGTTGGTTAATAGTTAACAACATAAAGCAAATAACTTACCTT

TTCCAGGACTTGGGTTTTCCAGTGGGAGAGGCAAGGTAGCACTCACTGCCTGCAGCCTCCAGAGCTGGTGCATTTGGTAGCTTTCTGTATACTGGGGAAG

CTGTACACGGAGGAGTGAGTTTGATAACTATGGCCTTGCACATGGATTACAATACCTCTAGTATCCGCTGAGTCTGTGGTCTCTTGTCTACAGTGAGATG

AACGTGAGCATTCATGACCTTTCAGTTTATTTATTTATGCATTTAGCACTGACAGTGGCCCAGATTATGGAGTTGCTCCTGCTGTCCCCGACTGCAGTTC

CCCATGCTCAGCAGGCACTGGTGGCCTGTTACGTAAGGTGCCATTTCTTATTCAACATTGATAACACGGAGGCAGAAATCATTATATCTCACTAATATGA

ATCACACAATTAGCTACAGATAGTAGGGAAATAAATTGTCATGAGCTATAGAAATATGTTTAATAATTATATATATATATATGAAGAAAAGTTTATAAAT

TCTTTAGAAGAGCTTTGATAACGATATTTTAAAAACAATCTATTCATACTATTAATGTGATGGGGTGTGGTGGCACACATTGTTAATTCTAGCATTTGGG

AGGCAGGGGCAGGCAAATCTCTGAGTTCGAGGCCAGCCTGGTCTGTTTATTCAAAACTCAAACCAACCAAACAAAAAGAATACCCATATTTTGTGAGAAA

CTATCAAAGCTCATGGTCTGTAAATTCCCATTCTGATATTAAATGAAAAAAATTAAGCTAAAAATGACTGTTTTAGAGACTGGAGGGTGTCCCGGCAGTT

AAGGGCACTTTCTGCTTTTCCATAGGACCAGAGTTTGTTTCCCAGCACCCATGGCAGGCAGTCCTTAACTGTCTGTAACTCCAGAAGAGCTGACACTCGC

TCTGGCCTCTGTAGGCACCCAAACACACATGGCATGCATTCACATAGAAACATACATACATACACATTAAGTAGACAATAAATCATTTTTTAAATGACTA

CTTTTATACTATCAAACAAATCTACTTGTGCTATTTTATTTTGTGGTTTTCTTTTGTTTATATTGCTCAAATTCTCTCTGTCAGCACTGTGGACCATCTA

TCAGTGGCTTTATAAGTACTGCAATAGAATTAATACCACAGAACTTTATCTATTTTCTGTCATGTTCAAGATACTGTACCGGCACCAATTTCTTAGGATG

TTTGTAAGAATCATCTTTTAAAATCTGTTGTGATTTAAGATGTTTTGTGAAGAGCAAGTGCCTAAGAGACAACGTTATCTAATCATCTTTTTGAGGCCAC

GGGTAATAGGCTGGGTTTCCAGTATGTCTGATTGCAGTTTCTGTAGCTACCTGCAGAGGCAGTGTTCTGATCGGTGTTTTGTAAATGTAAGGATTGTATT

TCAGAGCCTTGGGAGGGAAAGCCTAATTTCCTTGGGAGAATTGATGGAAGGGTAACTACAGCAACTCCCGAGTATATTTGACCACTTGCTCTGTCTGCAC

ATAGGAGATGTTCCCTATTTACACTGCAGACAGTTGAGTGGCCTTCTAGTTGTCCTGAGGACAGGAAGAGACAAGTGGGCAGGAGCTAAGGGAGATCAAT

TCAGATTCCTGGACACTGCAGCTGTTCGAGCAATCCAACAGCCCAACCAGCTCCTTGGGAATGGAGTGAATTCAGCAGTTCTGGTGACTGTCATCCCGCC

CTGGTCTGAGTGTCTGTCTGGGTTAATTGAATTGGAGGTCAGCTCATTCTACAATGCTTTGATCGGGGTCTAAAATCTGAGGTAGGGAAAGGTAAAAAGC

AGGTACCCTCTCTTCAAATAGAAGCGCATGTTCCTTGTCAATCATTCTACTGTGATGGGCACTAGTGTCATCTGCTATTGTGTTTGTTATGGGTCTGGCT

GGCTCATCTGTCCTGTGCCATCTATTCTGGGTAGATCCTTGTTAGTAGAGACCCGCACCCTGGACAGTAAAAATAATGGAAAAAGTCTTTATGATCAAGT

GGAAAACTAATCCTGGAATTATTCTGCTTAATTCTCTGGACATTTTGTTTTTCCTCTTCCTTTCTTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCC

TTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTCCTTTTCTTTTCTTTTCCCACTGGTTTGCCAACTTTGTATTCCTGAATCACCAGTTCTGGTGCATTC

AGTTGGAATTAGTTCATGAAGTAACTGAAATTCTAAGCATTTGTGATTTATCAGGTCTAGAATGGATCTTAGAAAACTACATTGTCCCTTTCAGCCTGTG

AGCATGTTGGGCCTGCTGTTCTCTGTCTACTGCAATAGCAACTTGTCAGCTGTCGCTGCTCTACTCTTGCCGTGGCCAGGGGACCTCCCTCTTACACCAT

GTTGTGTCATACATCTCTCAGTGGTTTACTTTTTCCATCCCGTGTACTGGGCAGATGATAGAGCTCCGTGGCTTGTTTGAACATTGGCCTTTACCCACCT

CTCACCCCTGTGAACTTCTTGTGTGCCATCTCAAAGTCTTTATTTTTAAGATTACTAGGTTATTTTAGAAACTATCTTCGATGTCACAGCTGTTGGGGTT

GTAGAAATATTTGTAGATTTCATGAGTAAGACAATTTATGAAAAATCTAGTGACCCCTTTGCAAGACTTTGGCATTATGGAAATGCTAACATTGGTTCTC

GTAGCTAGCCCATTATACTATTTAAAGGTTGTTAGGCACAATTTATTTCCCTTAGGGAGTAACATAAAAGGTGACTTAACTAAATTTAAATATTTCATGC

CTTCCAGTTGCCTATTGTGAATATCTTGAGTGTGTGTGCCTAAGCGATATACATAATACAAGTTTTAATCTCTTTAAGCATCTCTTGATTAGATGCAGGG

GTAGCTCTAATGTATCAATAGACCGGTATCAGTAAGTAATATAAAATAACCCATATTGGATAATCCTTCATGCCCTTTTAGGATGAAAGCATTTCTCCGA

GTTACTTTCTTCCTCAGAGCCCAGTTGTCTACGTACTTTCCTTTATGTATTAGCTGGCCAGAACCCTGCATCTTTAGTTAGTATTTTTTTTTGGCATATT

GTACATTTGCTGTTAGCTCTTGTTATTTTAGAATGCTGAACTTGAAATATAATGTAAAGGGCACATCAGACTTTATCATCATGGAAGATAGACTTCACAT

TGAATGGTCCTCTCTGACCTGGACAGCCTTTCACATGGGGAACAATTTAAATCCATCCCAATCCATTTCTAAAACCTCATTGCTGCAGGAAGAAGCAGCA

AGAAGAGCTCTTCTGTGTATTGAGGTGGCTGAGCAGGTTCTTAGCCTTAACCATGCAGAAGAAGGATTCGTGGATGCAGCCCCATTCCCTTCTAATTGCA

CTGTGTACAGTGACAGAGTCAGCACAGTATTGCTGCGACAGGACTTTGTGTGCAAAGATCAAAGCAGCTGCCTTACTGTGTTTAAATAATAAAGAATGTC

TGCACATGCCTACAGGTTGAATTGAATTTTATTTTGTGGTGCTAGAAATGGACCACGGAGGGCTGGTGTAGGCTTTGGAAGTGCGCTATACCTGAGCCAC

ATCCTCAGCCCCAGGTTGAATATTGAATGGAAAAAGTCAAGGTCTGCTAATATCAAACTTACTGACAGTAAGTGCACACCGCACCTTGTATGTCACAGCC

CAGTGGTTCTTAGGTTCTGTGTAATTTAAAGGATAAATTTAGGGGACACTGGGTGCATTTAATTTTATTGCACATTAACTTTTTTTATTTAAATATTTTT

AAGGACTTTGAATTAAAAGTCTTCGTAGTTTGTGTACCAAAAGAAAAGAAAAAGAAATTGTTTTCAGTGGAACGTAACTGATAATGAGAGTATCTGAATA

ACTGAACATATTAAGGAATATTACTTACATTTATCTAGGAAGGAATTGCATTATTCTGAGTTTGAAGTATACTCAGATTGAAGGTGTGACTCATTCTGCT

TGAGGAATCACACACACACACACACACACAAACACCTTACTTTAGTCTTATCTTAATGGAGCAGGAGACCCAGGCAGGTCACAGTTTTGGAGATAGTAGA

TGAGTATAAATAATTTTCACAAATTCCCATTTTTCCTGAAGTAATTTTTTCCCCACAGTAGACAGTTAAGTGTTTTCGGTACAGCTCTCCCCTTGCCCAC

TCTTGTATTAAACCAAGGTTACCAGCACGGGTGCTAAGTAAGCTCGGGACCACAGAGCACTTGGCCCAAGGGATTTATTTTTAACTTGCACAAAAGAGAG

AGATTATGGTAAACATTTTAAATCTCAGGCTCTTGGTTCTGTTGGGTCCAGATTACCCAAGACCTAGAGAGACTGCGTGTCACTGGCTCGTGCTGTACAG

GAAACCACTTATGGTTGACAGTGGGTTGTGCACCGTCACTGTGTCATGGGGATTCCAGAAGCCACGTCTTCACCGCTTTCATCAGTTTTTCCTTTTGTTG

ACTGTTGGCATCTGACCACCTGGGTGAATATCAGCTGTCTCTTTATAGATTACTATTTTAAAATATTTATTTCAGATGTTCATAGAATGTTCAATTTTTT

GATGCAAGTTATTTACAGAGGCATATATATTTAATAATTGAGATATATTATTTTATTGCACAACCTATTTTCCAAAGCAAATTTACTTTGTAGGTGTTTG

TCTTTTTGTGAAGAAAAAAATGTTTTTTTCTTTTGCCTCAAAATACAAGTTGTAAACCTGTCTTCTGGCGTAAGTGACTCTTGTGATAATATTTGCTTTC

CGCTTATTTGTGAACCAGTTTGGAGTTGCCAGTTGAACCCTCAGAGCTCCCCTCTGACCTGGATTCAGTGCAGTGCTGGTCAAACTTGGCATTGTTTCCC

TGCCTCGGTTTCCTCTCCTCATTGCACTTGAGTTTGGCCTCCGTTAGTTCGTTTTTCAGCAATCAGTTTTACAGAGGAAAACCGCCTTAGGAATTGAAGA

GGTTAGAACTCTTTGTAAATCGAATGTGTTATTAACATCTGTCTGCTAATAAGTGGATTAAGGTCTGGTCCTAGAGAAAGAGACCAGCTAGAAAGAACAA

GAAAAGTGCAAATATTTTTGATGTAAATGTTGTGTTCCCGTGACTTTTCATATGCTGATTTTATGTTAATGTGATCACCTGTGATATTTAAGTGACCGCA

GATAAAGATTTAATTTTCAACCTGAAGACGGCAGGTCCTGTTTCTATTTTTAATATTGAGACAGTTTTGAAAACAGATGTCGTATTATAAATTGTATTTT

TAAGTGGAAATAAATCAATTTGAAAGTCAGTGTTTTCCTTTTCTTTGTCCCTTACAGAAGGCTCTGTGTTATTAGATATATATTTAAGTTGCCAGATTAT

TTTCAGAATTCTCTATTTTCATATCGCTGTAACCAGTTTGCCTACAATGTGCAATTGAATTGTTATTTAATAAATGACACGTGATGGG
Translation
MALVGSRVELDADE - UNI8596 - DIFEDALETISR - UNI9513 - RSPSDMATSGFHFVPCETKRTSRQLGASAMGRPEG - UNI19984 -

 GSSAKVDLKSGLEECAEALNLFLSNKFKDALELLRPW - UNI19291 - WAKESMYHALGYSTIVVLQAVMTFEQQDIQNGISAMKDALQTCQK - 

UNI19585 - KYRKKCTVVESFSSLLSRGSLEQLSEE - UNI16509 - - UNI21596 - EEMHAEICYAECLLQKAALTFVQ DENMINFIKGG

LKIRTSYQIYK - UNI26782 - KECLSILHVIQKNKQEQHFFYEFEGGVKLGTGAFNL MLSLLPARIIRLLEFIGFSGNR DLGLLQLREGASGSS

MRSPLCCLTILAFHTYISLILG GTGEVNVVEAESLLAPFLQQFPN - UNI31298 - GSLILFYHARIELLKGNTEK - UNI31298 - AQETFR

KCISVQEEWKQFHHLCYWELMWIHIYQQNWMQAYYYSDLLCKESKWSK - UNI25792 - - UNI31298 - ATYVFLKAAILSMLPEEEVAATKEN

VVSLFR RQVDGLKQRIAGKSLPTEKFAVRKARRYSPPSGVPGKLVMPAL - UNI7939 - - UNI34217 - EMMYVWNGFSIVGKRKDLSENLLV

TVEKAEEALQNQD - UNI34217 - DFTDYSVDDECLVKLLKGCCLKNLERPLQAELCFNHVVES - UNI34217 - SEKLLKYDHYLVPFTLFEL

AFLYKSQGEIDKAIKVLETAR RNNYKDYSLESRLHFRIQAALHLWKKPSTD

For any suggestions or comments, please send an email to unitrap@crg.es