Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038214 (AK122525)
Chromosomal location
Chr 10: 43198946 - 43235202 (+)
Description
BEN domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:2677212]
RefSeq_dna
NM_199028 
RefSeq_peptide
NP_950193.1 
UniGene
Mm.472980 
MGI
MGI:2677212 
Uniprot/SWISSPROT
Q6PAL0 
Human Ortholog
ENSG00000178409 (BEND3)
Omim not available
UniTrap UNI29669
Vector Insertion
Chr 10: 43199179 - 43213447
Public Clones (sanger) E079F02 (ggtc) D161F08 (ggtc) 3SE287A11 (ggtc) E122G06 (ggtc)
E041E08 (ggtc) E091E11 (ggtc) D183D07 (ggtc) E062F06 (ggtc) E022E08 (ggtc)
5SE287A11 (ggtc) E091F12 (ggtc) IST14200C1 (tigm) IST14958B12 (tigm)
IST14578B9 (tigm) IST14602D1 (tigm) IST13235H7 (tigm) IST14267A2 (tigm)
IST14541D7 (tigm) IST14442C4 (tigm) IST14482E4 (tigm) IST11683F4 (tigm)
IST10070F10 (tigm) IST14208G4 (tigm) IST14114C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18663
Vector Insertion
Chr 10: 43213496 - 43213951
Public Clones not available
Private Clones OST418562 (lexicon) OST412597 (lexicon) OST389874 (lexicon) OST275002 (lexicon)
OST269773 (lexicon) OST249375 (lexicon) OST223458 (lexicon) OST215442 (lexicon)
OST204347 (lexicon) OST202445 (lexicon) OST202364 (lexicon) OST192964 (lexicon)
OST192930 (lexicon) OST142130 (lexicon) OST131841 (lexicon) OST131241 (lexicon)
OST39468 (lexicon) OST36427 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2416
Vector Insertion
Chr 10: 43214149 - 43229652
Public Clones (sanger) AC0496 (sanger) AD0373 (sanger) D112H01 (ggtc) IST13217D7 (tigm)
IST14378C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4314
Vector Insertion
Chr 10: 43233623 - 43233768
Public Clones AG0117 (sanger) XB424 (baygenomics) XB749 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040147
Sequence
AAATGACACACGGAGTCCCGTCACGTCACGCGAGAGCGCAGCGCACGGACACACACAAAGAGAGGGGAAAATACACGGCGCCCGCCCGCCCGCCGCCCCC

AGCCAGTCGGCGGGGCCGCCCCGGCCAGGCCCTGCGCGCTCGGCCCCCACTGCGGCCCGCGCGCCCGCCCCCCGCACGTGGCGCCCGAACTCGGCGCGGG

TCCCGCTCCGCAAAGTAACAACTCTCGTCCCAG - UNI29669 - TGGAATAGAAGATGAACTCAACTGAAATCAGTGAAGATGTAGAAGAAG - UN

I18663 - TTCTAAAAAATAACCCCGTGAAGGCAGAGGGCAGCGACGCTACCTTGGACTGCTCCCGGAACTCCAGGGCCTCCGAGAAGCACCTTCTGGA

GAGCGTCCTCACCGCCCTCCACGATTCCAGCAAGCGCAAGCAGCTGGACAGCGACGGCCAGCCAGACTCTGTCCCCAGTGTGAAGAGGAGGCGGCTGATA

CCCGAG - UNI2416 - GCGCTCCTGGCCGGCATGCGCACCCGTGAGAACAGTTCGCCCTGCCAGGGAAATGGAGAGCCTGCCAGCAGGGGCAGGAGT

GGAAGCTGTGCATGGCCTGCAGAAGAGGAACCTTCCACTGAGGCCACTGTCCCTTCCTACAAGAAGCCCCTGTATGGCATCTCCCACAAGATCATGGAGA

AGAAGAACCCTCCCTCGGGAGACCTGCTCAGCCCCTATGAGCTCTTTGAGAAGGCAAACTCCAGTAGCGGCCCTTCTCCCCTGCGCCTGCTCAGTGAGTC

TCAGAAGCGGGAATGTGGTGTCGGGGTTGCCACCGATGGGGACCTCAACATCTACTTCCTGATCCAGAAGATGTTCTACATGCTCAATGGACTCACGACT

AATATGTCCCAGCTTCACAGCAAGATGGACCTGCTGTCCCTCGAGGTGAGCCGTGTCAAGAAGCAGGTGAGCCCTTCCGAGCTGGTGGCCAAGTTCCAGC

CCCCGCCCGAGTACCAGCTCACTGCTTCCGAGCTGAAACAAATCGCCGAGCAGAGCCTGTCTTGCGGTGACCTAGCCTGTCGACTCCTTTTGCAGCTCTT

CCCAGAGCTCTTCAGCGACGTGGACTTCTCCCGCGGCTGCAGTGCCTGTGGCTTTGCCGCCAAGCGGAAGTTAGAGTCGCTGCACCTGCAGCTCATCCGC

AACTACGTAGAGGTCTACTACCCCAATGTGAAGGACACGGCTGTGTGGCAGGCCGAGTGCTTGCCGCAGCTCAATGACTTCTTCAGCCGCTTCTGGGCCC

AGAGAGAAATGGAAGACAGCCAGCCAGGCGGCCAGGTCACCAACTTCTTCGAAGCAGACCAAGTGGATGCCGGCCACTTTCTGGACAACAAGGACCAAGA

AGAAGCTCTGTCTCTGGACCGCAGCAGCACCATTGCCTCAGACCACGTGGTGGACACTCAGGACCTCACCGAGTTCCTAGATGAAGCCTCCTCTCCCGGT

GAGTTTGCTGTGTTCCTGCTACACCGGCTCTTCCCGGAGCTGTTCGACCACCGGAAGCTGGGCGAGCAGTACAGCTGCTATGGTGACGGGGGCAAGCAGG

AGCTGGACCCCCAGAGGCTGCAGATCATCCGCAACTACACAGAGATCTACTTCCCTGACATGCAGGAGGAGGAGGCTTGGCTGCAGCAGTGTGCCCAGCG

CATCAATGACGAGCTGGAGGGCCTGGGGCTGGAGGGAGGCAGCGAGGGTGAGGCACCGCGGGACGACTGCTATGACTCCTCTAGCCTGCCAGACGACATC

TCGGTGGTCAAGGTAGAGGACAACTTTGAAGGTGAGCGGCCTGGCCGGCGCTCCAAGAAGATCTGGCTGGTACCCATTGACTTTGACAAGTTGGAGATCC

CGCAGCCCGACTTCGAGATGCCAGGCTCAGACTGCCTTCTGAGCAAGGAGCAGCTGCGCAGCATCTATGAGAGCAGCCTGTCCATTGGCAACTTCGCCTC

CCGCCTGCTCGTGCACCTCTTCCCGGAGCTCTTCACCCACGAGAACCTGCGCAAGCAGTACAACTGCAGCGGCTCCCTGGGCAAGAAGCAGCTGGATCCG

GCCCGCATCAGGCTGATCCGCCACTACGTGCAGCTCCTCTACCCGAGAGCCAAGAACGACCGCGTGTGGACCCTGGAGTTCGTAGGCAAGCTGGACGAGC

GCTGTCGGCGCAGGGACACGGAGCAGCGCCGATCCTACCAGCAGCAACGCAAGGTCCATGTGCCTGGCCCCGAGTGCCGGGACCTAGCAAGTTACGCAAT

CAACCCCGAGAGGTTCCGTGAGGAGTTTGAGGGGCCCCCTCTGCCTCCTGAAAGGAGCAGCAAAGACTTTTGCAAAATACCCTTGGACGAGCTGGTGGTC

CCCTCACCTGACTTTCCGGTGCCTTCCCCCTACCTGCTGTCAGACAAGGAGGTTCGTGAGATCGTGCAGCAGAGCCTGTCGGTGGGCAACTTCGCGGCCC

GGCTCCTGGTCAGGCTCTTCCCGGAACTCTTCACGACCGAGAACCTCCGACTGCAGTACAACCACTCCGGGGCTTGTAACAAGAAGCAGCTGGACCCCAC

GAGGCTGAGGCTCATCCGCCATTACGTGGAAGCTGTCTACCCCGTGGAGAAGATGGAAGAGGTGTGGCACTATGAATGTATACCTAGCATTGATGAGCGG

TGTCGCCGTCCCAACAGGAAAAAGTGCGACATCCTCAAGAAAGCCAAGAAAGTGGAGAAGTGACAGGGTTGGGGCTGCCCAGGGACCTGGGTCACCGCAG

GCTGAGCAGTGGGTGCCCTTGGGACTGAGCATTGCTCAGGAGCTCGGATGGTACCCACAGACCGGCACCTTATGCCAGTGGGGAGTGGTTTCCTACATTT

GCACACGTAAACACCTACCCAGCCACAAGAAAGAAGCCTTGAATTTGGTCTTTTGTATTTATGACTTTGTTCTGTGTTCCCTGGTGGCACAGCCGGAGTT

TTGGGGGGGGTGGGGGGTAGCCAAGCTGTGAAATCAGAGAATTGGTAGGGTAGGGTCCCTTCACAGGGCTAGGGTGCCCTCCCTAACCCTTACGATTCAA

AATTCAAATTTAGACTAGATGTGGTAGCCCACCCTCTAGGCAGAGGCCACTGGAGTTTGAGGCCAGTCTAGTTAGTCTGCAGAGTGAATTCCAGCCCAGT

CAGGGCTGAACAATGAGACCCTGTCTGAAAAACAAGAAAATGCAAACGTAGCAACTTGTTTCTCTCTCCTCATGTTTTACATCTTCTATTTTTATCTTTT

TTTTATTATTAAAATGAATTTTTGAAGAATCATTAGGCTCTTTGGGAGCCATTTTATTTAGAAAAAAATCATAAAATATTTGAGATGAGATGCTGTAAGA

TTACTTCAGTTGCTGGGATTTTTTTAAAGATGATTTTAGATTTATGCTTTTTTCAAAAAAGAAGAAATGCCATATTCAGGCATTATGGGTAACTGTGGCT

TCAGGTGGCATAGTGACTAGTTTTACTAATCCTGTGTCTGATATCTGATTTTGGAAGAGTCCATAGACCCCCTTAGATTCAGCAGACGGGATGGATTATA

AGTAGTGTGTAGCCCCTTTCTTATTCTATGTGAGCTTCCGTTCTGCGGTGGCCCAGCCTGTCTGCCGCCGCCGTGTGGTGCTCGCTGTGTAGATGAGAAC

ACTGGAAGATGATCTGAATGTAGGTAGAACGGAGGCGTGGGTCCTTACAGCCTTCGTGGGAGCTGTGCCCTCCACACAGATGTTGCTGTAGAGGGACACA

TTGCAACACAGTGTGTAGGGACAGTTTTGTGTGATTTACGGGTGAGCTTTTGGGTTCACCGAGAACTGTTTACTTCCCATGTATTTGTACAAAGTCCGTG

TCCCCAGACCTCAGTGTTAGCTCCTCCCATGGTCTTGAACCTCCAAAGCCCCAGCCTAGGGCTCTTTTGCAGGTGTTGGAAGAACCCAAACCATCTTAAA

TGGAGTGCCCACACCCCTTCCCAGTCCCACCAGACCTTTTCCCTCAAACCTTGCAGGAAGTTCTGCCAGCCTACCCTGGCCCACCCCTAGCATGGAGGTG

CGTATCTCTTCCCCTTCTGCACTGGGGCCAGATGCCTAAGAAGGAAAGGAGACCGTGTTTCCCAAACTCAGTGCATCGCATCCCCGACCTAGAAGACTGA

GTTGCCCGGGGCAGTCATAAAACCCTTGTGGGACATTACAGACGTGATAACTTTAATGGCTTAATATTTTGCTACATTAATATGCAGAGGTGATAGAAAT

AATCTATGAATTTTCTCATAAAGATAAGAACTTTAGTTCTAGTAGACCACATGATATAATTTTGCATGTACCCAATGGGCATTCAATTTTCAATGCTATA

AAGCTTCTGTCCTCTGTCATTCTCAGATTATTTATGCTATAACTGTAAACCTAAATTATTGACATTGAGAAGTGCGCAGAGACTTTGTG - UNI4314 

- ACACACACACACACACACACACACACACACACGCTACCCCAAAGATGGCTGTGGCACTCTCTCACTGCTTCCACTGGTTGGAGAGAATTCCATGGGAT

TTGTTCTGGTCTTGAGGATGTAACCGAGAGGATTCCAAGCCATGTGAAAATTGTCCTGCTTTCCAGAAAGTGGAGTGTGGCCCTGCAACATCAGAAGCAC

AATCGGCCATTGAGTTTTTACAAGTCCCATCTCGTCACATCTGAGAAATGGCGGGCTCTAGGAACTGAGCGGGACTTTTTGTAACCCAGAGTGTGTTAAA

TTCTGGGAACCTGTATTTTGGTTTCCTTAATACTTTAACTATGTAGGGCTTCTCTCCTCCCAACCCCCACCTCCACCCCCAGTCCCATCATCCCTTCAGT

GAAAAAGAGCTGGTCACTCTGGGAGCTGTTTCCTGCCCACTGGACCGTATGGTGTCCTCACTCACCCATCCGTACAGGGAGTTCCAGTGGGCATTTTTTT

TTCATGAAGCAATATAAATATAAAATACTTATTTTTTCAGAATTTAATGGTTTTCATGAAATCTGTTGGCAACTACTTTCCCTGTCCTCATCTAAATTCT

TTGTTTGTGTTTTGGATGATTTTTGCCTTGTATCCAGAGGACTAAAGATTAGCCCCGATATTCTGATGTTCACTAAAATAGTATGTCACAGTAGGTGGTA

GTGGTCTTGGTTTTCTCTGTTAGTAAGCTGTTAAAGAATGTCTGAAGATACTCTTGAATGTACAGTGTTCGAATCCTGCTTTTATTCATGTGGCCGTGTC

TGTCTGATGGCAAACGTTTGTCAGGGAATCAATGTCTAGTGTCGTTAGTGCTCGCTGCCCTTCCCCTTCAGTGTTGAACCCCAAACCTTCCTTTCCTTTT

AAGTTAGGAAGTGAGGGGTTCATATCAGCAGCAATCATCAACTGACCAATGGGATCTACTTAGTGGCGACTGGATTTGGCCTGATCACACCACAGTGTGG

CCATTTGGGTCCTTGTAGAGATTGTCTCGGTTTCTACTATCCCCCCAGCAACTGCTTCCTACCTGATCCAGAGGGACCTGGAGACCCCTAGTTGGAGGTC

ACTGGGTCATTCTGAAGTGGGGGGTGAGGGCCCAAGGGCTGTCACTGCTGTGGGCAGTCTTTGTCTCTTGTAGATCCAGCCTTAATGTCTGACATCCCAG

GAAGCGCAGACCCTGCACAAAGTGGATATCAGAGCGATACTGTGAGGAGTAAGTAAGGAGCATAGGTTTACCAAAGAGAATGAGCTAGCACATCATGTCT

GCCTGTTACACTGATCTGAGTGCACCCTTAGAAAACTGAATGTACCACAGACCCAGGACAGTTTTGGAACTTGTATGCTCTCTAGCAACTTTGTGTGAAT

TTTTATACAAGCACTGTTTTATTAATTATATAAAAT
Translation
 - UNI29669 - MNSTEISEDVEEV - UNI18663 - VLKNNPVKAEGSDATLDCSRNSRASEKHLLESVLTALHDSSKRKQLDSDGQPDSVPSVK

RRRLIPE - UNI2416 - ALLAGMRTRENSSPCQGNGEPASRGRSGSCAWPAEEEPSTEATVPSYKKPLYGISHKIMEKKNPPSGDLLSPYELFEKAN

SSSGPSPLRLLSESQKRECGVGVATDGDLNIYFLIQKMFYMLNGLTTNMSQLHSKMDLLSLEVSRVKKQVSPSELVAKFQPPPEYQLTASELKQIAEQSL

SCGDLACRLLLQLFPELFSDVDFSRGCSACGFAAKRKLESLHLQLIRNYVEVYYPNVKDTAVWQAECLPQLNDFFSRFWAQREMEDSQPGGQVTNFFEAD

QVDAGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

MQEEEAWLQQCAQRINDELEGLGLEGGSEGEAPRDDCYDSSSLPDDISVVKVEDNFEGERPGRRSKKIWLVPIDFDKLEIPQPDFEMPGSDCLLSKEQLR

SIYESSLSIGNFASRLLVHLFPELFTHENLRKQYNCSGSLGKKQLDPARIRLIRHYVQLLYPRAKNDRVWTLEFVGKLDERCRRRDTEQRRSYQQQRKVH

VPGPECRDLASYAINPERFREEFEGPPLPPERSSKDFCKIPLDELVVPSPDFPVPSPYLLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTTENLRLQY

NHSGACNKKQLDPTRLRLIRHYVEAVYPVEKMEEVWHYECIPSIDERCRRPNRKKCDILKKAKKVEK - UNI4314 - 

For any suggestions or comments, please send an email to unitrap@crg.es