Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038252 (Ncapd2)
Chromosomal location
Chr 6: 125118027 - 125141613 (-)
Description
non-SMC condensin I complex, subunit D2 Gene [Source:MGI Symbol;Acc:MGI:1915548]
RefSeq_dna
NM_146171 
RefSeq_peptide
NP_666283.1 
UniGene
Mm.257590 
MGI
MGI:1915548 
Uniprot/SWISSPROT
Q8K2Z4 
Human Ortholog
ENSG00000010292 (NCAPD2)
Omim not available
UniTrap UNI23647
Vector Insertion
Chr 6: 125139927 - 125141515
Public Clones E052D03 (ggtc) (ggtc) IST12256A8 (tigm)
Private Clones OST250621 (lexicon) OST152362 (lexicon) OST148940 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17906
Vector Insertion
Chr 6: 125137171 - 125139780
Public Clones not available
Private Clones OST433931 (lexicon) OST233950 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3958
Vector Insertion
Chr 6: 125124377 - 125126160
Public Clones AS0137 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2700
Vector Insertion
Chr 6: 125121966 - 125123007
Public Clones AL0224 (sanger) IST10492F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14974
Vector Insertion
Chr 6: 125118026 - 125118767
Public Clones PST12506-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043848
Sequence
GTTTGGCGCGTATCCTGCCCTATTGTTTTCTTCCTTCCTTTTCAGCAGGGGGCTCTCCGGTTGAAGAAGCGGCGGGTGAGGGGTGTCGCGGGGTCCAG -

 UNI23647 - GTGAACCAGGGGGAGAAAGATGTCTCCCCACAACTTTGAATTCCACTTGCCCTTATCTCCAGAGGAGCTGCTGAAAAGTGGAGGTGTG

AATCAGTACGTTGTCCGGGAGGTGCTGCCCGTCAAGCACCTCTCATCCCAGCTTAGAG - UNI17906 - CATTTCAGTCTGCCTTCCGAGCTCAGGG

GCCCCTCGCCATACTGGAGCACTTCGATACAGTCTACAGCATTTTACA TCACTTTCGAAGTATAGAACCTGGCCTCAAGGAAGACACTCTGGAATTCCT

GAAGAAAG TGGTATCCCGCCACTCCCAGGAACTGTCGTCCATCCTGGATGATGCAGCTCTGAGTGGATCAGATAGAAGCGCCCACCTGAATGCCCTCAA

AATGAACTGCTATGCCCTGATACGCCTTTTGGAGTCCTTTGAGAATATGACCAGCCAGACAAGCCTCATTGACCTGGACATCGGTGGGAAG GGTAAGAG

AGCCCGGGCCAAAGCAACCCTTGGCTTTGACTGGGAGGAAGAGAGGCAACCAGTTCTTCAGCTTTTAACACAGCTGCTCCAGCTGGACATCCGTCACCTA

TGGAACCACTCAGCAATTGAAGAAGAATTTGTCAG TTTGGTTACTGGCTGTTGCTACCGCCTTTTGGAGAATCCCACCATTAGTCACCAGAAGAACCGC

TCCACCAAGGAGGCCATAGCACACCTGCTTGGGGTGGCCTTGGTCCGCTACAACCATATGCTCA GTGCCACTGTGAAGATCATCCAGATGTTGCAGCAC

TTTGAGCACCTGCCCCCTGTGTTGGTGACAGCCGTGAGTCTGTGGGCAACAGACTACGGGATGAAGAGCATAGTGGGAGAGATTGTAAG AGAGATTGGA

CAGAAGTGTCCACAGGAGCTGAGTCGAGACACAGCAGGGGCAAAGGGCTTTGCGGCTTTCCTCACTGAGCTAGCAGAGCGAATCCCAGCTGTCCTGATGG

CCAACATGTGCATTCTGCTAGACCATCTGGATGGAGAG AATTACATGATGCGCAATGCTGTGTTAGCAGCTATAGCCGAGATGGTACTGCAGGTTCTAA

ATGGTGACCAGCTCGAAGAATCAGCTCGAGAAACCAGAGATCAGTTCTTGGACATCTTGCAAGCTCATGGCCATGATGTGAACTCTTTTGTTCGGAGCCG

TGTTTTGCAGCTCTTTGCCCGAATTGTCCAACAGAAG GCACTCCCTCTGACCCGTTTCCAGGCAGTGGTGGCCTTGGCAGTGGGACGGCTGGCAGACAA

GTCAGTGCTAGTGTGTAAAAATGCCATTCAGCTGCTGGCCAGCTTTCTAGCCAATAATCCCTTTTCCTGCAAG CTTAGTGATATTGACCTTGCTGGACC

ACTGCAGAAGGAGATTCAGAAATTACAAGAAATGCGAGCCCAGAGGCGAAGTGCAGCAGCGA CTGCAGCACTAGACCCGGAGGAGGAGTGGGATGCCAT

GTTGCCAGAATTGAAGTCGACCCTGCAGCAGCTCCTGAAACTTCCCCAGGAAGAGGGAGATCATCAAATTGCTGATGCAGAGACTGCAGAGGAGGTGAAA

GGACGCATCCGCCAACTGCTTGCCAAAGCAAGTTACAA ACAGGCTATTGTTCTCACTCGGGAAGCTACCAGTCACTTCCAGGAGTCTGAACCCTTCAGT

CACACAGAGCCAGAGGAGAACAGCTTCCTGAATCTCTTGGGACTCATCTTCAAAG GCCCCGAAGCTTCCACACAGGGCTCTCATGGGGACACAGACCCA

GGGCTGACAGGCAGTAAAGACTCTCCCAGTGTGCCCGAGCCAGAGGGATCCCAGAGCAACGATGAGCTGGTGAAGCAGGAGATGCTGGTGCAGTATCTGC

AGGATGCCTACGGCTTCTCCCAGAAGATTACAGAAGCCATTGGCATCATCAGCAAGATGATGTATGAGAACACAACTACAG TGGTGCAGGAGGTGATTG

AGTTCTTCGTGATGGTATTCCAATTTGGGGTACCTCAGGCCCTGTTTGGGGTACGCCGCATGCTGCCACTCATCTGGTCTAAGGAGCCTGGTGTCCGGGA

AGCCGTGCTTAATGCGTACCGCCAACTCTACCTCAACCCGAAAGGGGACTCAGCCAG AGCCAAGGCGCAGACTTTGATTCACAACCTCTCGCTGTTGTT

AGTGGATGCCTCCGTCGGGACCATTCAGTGTCTTGAGGAAATT - UNI3958 - CTTTGTGAGTTTGTGCAGAAGGATGAGGTAAAGCCAGCGGTGAT

CCAGCTGCTATGGGAACGGGCAACGGAGAAGGTGCCAAGCTCTCCTCTGGAGCGCTGCTCCTCTGTTATGCTTCTTGGCATGATGGCACG AGGAAAACC

AGAAATTGTAGGGAGCAACTTAGACGCCCTGGTGAGGGTGGGGCTGGATGAGAAGTCTCCCCAGGACTACAGGCTGGCCCAGCAGGTGTGCCTTGCCATT

GCTAACATCTCGGACAGGAGGAAG CCTTCCCTGGGTGAGCGTCACCCTCCCTTCCGGCTGCCTCAGGAGCACAGGTTGTTTGAGCGACTTCAGGATATG

GTCACAAAGG GCTTTGCACACCCAGATCCCCTCTGGATCCCATTCAAAGAAGTAGCAGTGACCCTGACCTACCAGTTGGCAGAGAGCCCTGATGTGCTC

TGTGCCCAGATGTTGCAAGGCTGTGCCAAGCAAGTCTTGGAGAAACTTGAGAAGAACGCCACTGAGGCAGACCCCA AGGAAACAGCCCCTAGGCTCCCC

ACATTCCTGCTGATGAACCTGCTGTCCCTGGCTGGGGATGTGGCTCTACAGCAGCTGGTGCATTTGGAACAAGCAGTGAGTGGAGAGCTGGGTCGGCGGC

GAGTTCTGCGAGAGGAGCAGGAGCACAGGGCCAAGGAGCCCAAGGAGAAG - UNI2700 - ACTGCAAGCTCTGAAACTACAATGGAGGAAGAACTGG

GGCTGGTGGGGGGGGCCACTGCTGACGACACAGAGGCGGAGCTCATCCGAAGCATCTGTGAGAAGGAGCTGTTGGACG GCAACCAGGTACTAGCTGCCT

TTGTTCCACTGCTACTTAAAGTCTGTAACAACCCTGGCTTATACAGCAACCCAGAGCTCTGTGCGGCTGCGTCGCTGGCCCTTGGCAAGTTCTGCATGAT

CAG TGCCCCTTTCTGCGACTCCCAGCTTCGTCTTCTATTCACCATGCTGGAAAAGTCTTCACTCCCCACTGTGCGATCTAACCTCATGGTTGCCACAGG

GGATCTGGCTATCCGCTTCCCTAACCTGGTGGATCCCTGGACTCCTCATCTGTATGCCCG CCTCCGAGACCCAGCTCAACAAGTGCGGAAGACAGCGGG

GCTGGTGATGACGCACCTGATCCTGAAGGACATGGTGAAGGTGAAGGGGCAGGTGAGCGAGATGGCCGTGCTGCTCATCGACCCTGTGCCTCAGATCGCT

GCTCTGGCCAAGAATTTCTTCAATGAGCTCTCCCACAAG GGCAATGCTATCTATAATCTACTCCCCGATATCATCAGTCGCCTGTCAGACCCAGAGGGC

GGAGTGGAAGAGGAGCCCTTCCACACCATCATGAA GCAGCTCCTCTCCTACATCACCAAGGACAAACAGACTGAGAGCTTGGTAGAAAAGCTGTGTCAG

CGGTTCCGCACAGCCCG AACTGAGCGTCAGTACCGAGACCTAGCCTACTGTATGTCCCAGCTGCCCCTCACAGAGCGAGGTCTCCAGAAGATGCTAGAC

AACTTTGAGTGCTTTGGCGATAAGCTCTTAGATGAGTCTGTCTTCAGTGCTTTCTTGTCAGTTGTGGGCAAACTGCGTCGCGGGGCCAAGCCTGAGGGCA

AG GCTATAATAGATGAATTTGAGCAGAAGCTTCGTGCCTGTCACACCAGAGGCATGGATGGAATAGAGGAGTTTGAAACTGGCCAGGGAGGCAGCCAGC

GAGCCCTGTCTGCCAAGAAACCCTCCGCTG - UNI14974 - TCTCAAGGCTACAGCCTCTGACTTCTGTAGACTCAGACAATGACTTTGTCACACCT

AAGCCGCGACGTACCAAACCTGGTCGTCCACAAACTCAGCAGCGCAAGAAGTCCCAGAGGAAAGCCAAAGTTGTCTTCTTGAGTGACGAGTCCAGTGAGG

ACG - UNI14974 - AACTTTCAGCAGAGATGACAGAAGAAGAGACACCCAAGAGAACCACCCCCATCCGCAGAGCATCTGGGCGAAGACACAGGTCC

TAGGAGCTGCCTTTGCCTACTCCCGTCCCTGCCGTGCAGGGTATCTTACTGGATGATCTTGGATTCAGTGCCCCCCCCCCCTTGTAGAAGTGCTTGTTGT

CTGTGGTTTTAACATGGAAATGGCCTTTGCATTGAGGTCTTTCTCTTAGAGCCCTGCTGCCACTTTCCCTTTCTCCGAGCCTGTGCCAATTGCTGTTTTC

TAATGAATAAATGTTTTTATAGACTTTT
Translation
 - UNI23647 - MSPHNFEFHLPLSPEELLKSGGVNQYVVREVLPVKHLSSQLRA - UNI17906 - AFQSAFRAQGPLAILEHFDTVYSILH HH

FRSIEPGLKEDTLEFLKKV VVSRHSQELSSILDDAALSGSDRSAHLNALKMNCYALIRLLESFENMTSQTSLIDLDIGGK GKRARAKATLGFDWEEER

QPVLQLLTQLLQLDIRHLWNHSAIEEEFVS SLVTGCCYRLLENPTISHQKNRSTKEAIAHLLGVALVRYNHMLS SATVKIIQMLQHFEHLPPVLVTAV

SLWATDYGMKSIVGEIVR REIGQKCPQELSRDTAGAKGFAAFLTELAERIPAVLMANMCILLDHLDGE NYMMRNAVLAAIAEMVLQVLNGDQLEESAR

ETRDQFLDILQAHGHDVNSFVRSRVLQLFARIVQQK ALPLTRFQAVVALAVGRLADKSVLVCKNAIQLLASFLANNPFSCK LSDIDLAGPLQKEIQKL

QEMRAQRRSAAAT TAALDPEEEWDAMLPELKSTLQQLLKLPQEEGDHQIADAETAEEVKGRIRQLLAKASYK KQAIVLTREATSHFQESEPFSHTEPE

ENSFLNLLGLIFKG GPEASTQGSHGDTDPGLTGSKDSPSVPEPEGSQSNDELVKQEMLVQYLQDAYGFSQKITEAIGIISKMMYENTTTV VVQEVIEF

FVMVFQFGVPQALFGVRRMLPLIWSKEPGVREAVLNAYRQLYLNPKGDSAR RAKAQTLIHNLSLLLVDASVGTIQCLEEI - UNI3958 - LCEFVQ

KDEVKPAVIQLLWERATEKVPSSPLERCSSVMLLGMMAR RGKPEIVGSNLDALVRVGLDEKSPQDYRLAQQVCLAIANISDRRK PSLGERHPPFRLPQ

EHRLFERLQDMVTKG GFAHPDPLWIPFKEVAVTLTYQLAESPDVLCAQMLQGCAKQVLEKLEKNATEADPK KETAPRLPTFLLMNLLSLAGDVALQQL

VHLEQAVSGELGRRRVLREEQEHRAKEPKEK - UNI2700 - TASSETTMEEELGLVGGATADDTEAELIRSICEKELLDG GNQVLAAFVPLLLKVC

NNPGLYSNPELCAAASLALGKFCMIS SAPFCDSQLRLLFTMLEKSSLPTVRSNLMVATGDLAIRFPNLVDPWTPHLYAR RLRDPAQQVRKTAGLVMTH

LILKDMVKVKGQVSEMAVLLIDPVPQIAALAKNFFNELSHK GNAIYNLLPDIISRLSDPEGGVEEEPFHTIMK KQLLSYITKDKQTESLVEKLCQRFR

TAR RTERQYRDLAYCMSQLPLTERGLQKMLDNFECFGDKLLDESVFSAFLSVVGKLRRGAKPEGK AIIDEFEQKLRACHTRGMDGIEEFETGQGGSQR

ALSAKKPSAV - UNI14974 - VSRLQPLTSVDSDNDFVTPKPRRTKPGRPQTQQRKKSQRKAKVVFLSDESSEDE - UNI14974 - ELSAEMTE

EETPKRTTPIRRASGRRHRS
Transcript ENSMUST00000112291
Sequence
GTTTGGCGCGTATCCTGCCCTATTGTTTTCTTCCTTCCTTTTCAGCAGGGGGCTCTCCGGTTGAAGAAGCGGCGGGTGAGGGGTGTCGCGGGGTCCAG -

 UNI23647 - GTGAACCAGGGGGAGAAAGATGTCTCCCCACAACTTTGAATTCCACTTGCCCTTATCTCCAGAGGAGCTGCTGAAAAGTGGAGGTGTG

AATCAGTACGTTGTCCGGGAGGTGCTGCCCGTCAAGCACCTCTCATCCCAGCTTAGAG - UNI17906 - CATTTCAGTCTGCCTTCCGAGCTCAGGG

GCCCCTCGCCATACTGGAGCACTTCGATACAGTCTACAGCATTTTACA TCACTTTCGAAGTATAGAACCTGGCCTCAAGGAAGACACTCTGGAATTCCT

GAAGAAAG TGGTATCCCGCCACTCCCAGGAACTGTCGTCCATCCTGGATGATGCAGCTCTGAGTGGATCAGATAGAAGCGCCCACCTGAATGCCCTCAA

AATGAACTGCTATGCCCTGATACGCCTTTTGGAGTCCTTTGAGAATATGACCAGCCAGACAAGCCTCATTGACCTGGACATCGGTGGGAAG GGTAAGAG

AGCCCGGGCCAAAGCAACCCTTGGCTTTGACTGGGAGGAAGAGAGGCAACCAGTTCTTCAGCTTTTAACACAGCTGCTCCAGCTGGACATCCGTCACCTA

TGGAACCACTCAGCAATTGAAGAAGAATTTGTCAG TTTGGTTACTGGCTGTTGCTACCGCCTTTTGGAGAATCCCACCATTAGTCACCAGAAGAACCGC

TCCACCAAGGAGGCCATAGCACACCTGCTTGGGGTGGCCTTGGTCCGCTACAACCATATGCTCA GTGCCACTGTGAAGATCATCCAGATGTTGCAGCAC

TTTGAGCACCTGCCCCCTGTGTTGGTGACAGCCGTGAGTCTGTGGGCAACAGACTACGGGATGAAGAGCATAGTGGGAGAGATTGTAAG AGAGATTGGA

CAGAAGTGTCCACAGGAGCTGAGTCGAGACACAGCAGGGGCAAAGGGCTTTGCGGCTTTCCTCACTGAGCTAGCAGAGCGAATCCCAGCTGTCCTGATGG

CCAACATGTGCATTCTGCTAGACCATCTGGATGGAGAG AATTACATGATGCGCAATGCTGTGTTAGCAGCTATAGCCGAGATGGTACTGCAGGTTCTAA

ATGGTGACCAGCTCGAAGAATCAGCTCGAGAAACCAGAGATCAGTTCTTGGACATCTTGCAAGCTCATGGCCATGATGTGAACTCTTTTGTTCGGAGCCG

TGTTTTGCAGCTCTTTGCCCGAATTGTCCAACAGAAG GCACTCCCTCTGACCCGTTTCCAGGCAGTGGTGGCCTTGGCAGTGGGACGGCTGGCAGACAA

GTCAGTGCTAGTGTGTAAAAATGCCATTCAGCTGCTGGCCAGCTTTCTAGCCAATAATCCCTTTTCCTGCAAG CTTAGTGATATTGACCTTGCTGGACC

ACTGCAGAAGGAGATTCAGAAATTACAAGAAATGCGAGCCCAGAGGCGAAGTGCAGCAGCGA CTGCAGCACTAGACCCGGAGGAGGAGTGGGATGCCAT

GTTGCCAGAATTGAAGTCGACCCTGCAGCAGCTCCTGAAACTTCCCCAGGAAGAGGGAGATCATCAAATTGCTGATGCAGAGACTGCAGAGGAGGTGAAA

GGACGCATCCGCCAACTGCTTGCCAAAGCAAGTTACAA ACAGGCTATTGTTCTCACTCGGGAAGCTACCAGTCACTTCCAGGAGTCTGAACCCTTCAGT

CACACAGAGCCAGAGGAGAACAGCTTCCTGAATCTCTTGGGACTCATCTTCAAAG GCCCCGAAGCTTCCACACAGGGCTCTCATGGGGACACAGACCCA

GGGCTGACAGGCAGTAAAGACTCTCCCAGTGTGCCCGAGCCAGAGGGATCCCAGAGCAACGATGAGCTGGTGAAGCAGGAGATGCTGGTGCAGTATCTGC

AGGATGCCTACGGCTTCTCCCAGAAGATTACAGAAGCCATTGGCATCATCAGCAAGATGATGTATGAGAACACAACTACAG TGGTGCAGGAGGTGATTG

AGTTCTTCGTGATGGTATTCCAATTTGGGGTACCTCAGGCCCTGTTTGGGGTACGCCGCATGCTGCCACTCATCTGGTCTAAGGAGCCTGGTGTCCGGGA

AGCCGTGCTTAATGCGTACCGCCAACTCTACCTCAACCCGAAAGGGGACTCAGCCAG AGCCAAGGCGCAGACTTTGATTCACAACCTCTCGCTGTTGTT

AGTGGATGCCTCCGTCGGGACCATTCAGTGTCTTGAGGAAATT - UNI3958 - CTTTGTGAGTTTGTGCAGAAGGATGAGGTAAAGCCAGCGGTGAT

CCAGCTGCTATGGGAACGGGCAACGGAGAAGGTGCCAAGCTCTCCTCTGGAGCGCTGCTCCTCTGTTATGCTTCTTGGCATGATGGCACG AGGAAAACC

AGAAATTGTAGGGAGCAACTTAGACGCCCTGGTGAGGGTGGGGCTGGATGAGAAGTCTCCCCAGGACTACAGGCTGGCCCAGCAGGTGTGCCTTGCCATT

GCTAACATCTCGGACAGGAGGAAG CCTTCCCTGGGTGAGCGTCACCCTCCCTTCCGGCTGCCTCAGGAGCACAGGTTGTTTGAGCGACTTCAGGATATG

GTCACAAAGG GCTTTGCACACCCAGATCCCCTCTGGATCCCATTCAAAGAAGTAGCAGTGACCCTGACCTACCAGTTGGCAGAGAGCCCTGATGTGCTC

TGTGCCCAGATGTTGCAAGGCTGTGCCAAGCAAGTCTTGGAGAAACTTGAGAAGAACGCCACTGAGGCAGACCCCA AGGAAACAGCCCCTAGGCTCCCC

ACATTCCTGCTGATGAACCTGCTGTCCCTGGCTGGGGATGTGGCTCTACAGCAGCTGGTGCATTTGGAACAAGCAGTGAGTGGAGAGCTGGGTCGGCGGC

GAGTTCTGCGAGAGGAGCAGGAGCACAGGGCCAAGGAGCCCAAGGAGAAG - UNI2700 - ACTGCAAGCTCTGAAACTACAATGGAGGAAGAACTGG

GGCTGGTGGGGGGGGCCACTGCTGACGACACAGAGGCGGAGCTCATCCGAAGCATCTGTGAGAAGGAGCTGTTGGACG GCAACCAGGTACTAGCTGCCT

TTGTTCCACTGCTACTTAAAGTCTGTAACAACCCTGGCTTATACAGCAACCCAGAGCTCTGTGCGGCTGCGTCGCTGGCCCTTGGCAAGTTCTGCATGAT

CAG TGCCCCTTTCTGCGACTCCCAGCTTCGTCTTCTATTCACCATGCTGGAAAAGTCTTCACTCCCCACTGTGCGATCTAACCTCATGGTTGCCACAGG

GGATCTGGCTATCCGCTTCCCTAACCTGGTGGATCCCTGGACTCCTCATCTGTATGCCCG CCTCCGAGACCCAGCTCAACAAGTGCGGAAGACAGCGGG

GCTGGTGATGACGCACCTGATCCTGAAGGACATGGTGAAGGTGAAGGGGCAGGTGAGCGAGATGGCCGTGCTGCTCATCGACCCTGTGCCTCAGATCGCT

GCTCTGGCCAAGAATTTCTTCAATGAGCTCTCCCACAAG GGCAATGCTATCTATAATCTACTCCCCGATATCATCAGTCGCCTGTCAGACCCAGAGGGC

GGAGTGGAAGAGGAGCCCTTCCACACCATCATGAA GCAGCTCCTCTCCTACATCACCAAGGACAAACAGACTGAGAGCTTGGTAGAAAAGCTGTGTCAG

CGGTTCCGCACAGCCCG AACTGAGCGTCAGTACCGAGACCTAGCCTACTGTATGTCCCAGCTGCCCCTCACAGAGCGAGGTCTCCAGAAGATGCTAGAC

AACTTTGAGTGCTTTGGCGATAAGCTCTTAGATGAGTCTGTCTTCAGTGCTTTCTTGTCAGTTGTGGGCAAACTGCGTCGCGGGGCCAAGCCTGAGGGCA

AG GCTATAATAGATGAATTTGAGCAGAAGCTTCGTGCCTGTCACACCAGAGGCATGGATGGAATAGAGGAGTTTGAAACTGGCCAGGGAGGCAGCCAGC

GAGCCCTGTCTGCCAAGAAACCCTCCGCTG - UNI14974 - TCTCAAGGCTACAGCCTCTGACTTCTGTAGACTCAGACAATGACTTTGTCACACCT

AAGCCGCGACGTACCAAACCTGGTCGTCCACAAACTCAGCAGCGCAAGAAGTCCCAGAGGAAAGCCAAAGTTGTCTTCTTGAGTGACGAGTCCAGTGAGG

ACG - UNI14974 - AACTTTCAGCAGAGATGACAGAAGAAGAGACACCCAAGAGAACCACCCCCA - UNI14974 - CCCTTGTAGAAGTGCTTG

TTGTCTGTGGTTTTAACATGGAAATGGCCTTTGCATTGAGGTCTTTCTCTTAG
Translation
 - UNI23647 - MSPHNFEFHLPLSPEELLKSGGVNQYVVREVLPVKHLSSQLRA - UNI17906 - AFQSAFRAQGPLAILEHFDTVYSILH HH

FRSIEPGLKEDTLEFLKKV VVSRHSQELSSILDDAALSGSDRSAHLNALKMNCYALIRLLESFENMTSQTSLIDLDIGGK GKRARAKATLGFDWEEER

QPVLQLLTQLLQLDIRHLWNHSAIEEEFVS SLVTGCCYRLLENPTISHQKNRSTKEAIAHLLGVALVRYNHMLS SATVKIIQMLQHFEHLPPVLVTAV

SLWATDYGMKSIVGEIVR REIGQKCPQELSRDTAGAKGFAAFLTELAERIPAVLMANMCILLDHLDGE NYMMRNAVLAAIAEMVLQVLNGDQLEESAR

ETRDQFLDILQAHGHDVNSFVRSRVLQLFARIVQQK ALPLTRFQAVVALAVGRLADKSVLVCKNAIQLLASFLANNPFSCK LSDIDLAGPLQKEIQKL

QEMRAQRRSAAAT TAALDPEEEWDAMLPELKSTLQQLLKLPQEEGDHQIADAETAEEVKGRIRQLLAKASYK KQAIVLTREATSHFQESEPFSHTEPE

ENSFLNLLGLIFKG GPEASTQGSHGDTDPGLTGSKDSPSVPEPEGSQSNDELVKQEMLVQYLQDAYGFSQKITEAIGIISKMMYENTTTV VVQEVIEF

FVMVFQFGVPQALFGVRRMLPLIWSKEPGVREAVLNAYRQLYLNPKGDSAR RAKAQTLIHNLSLLLVDASVGTIQCLEEI - UNI3958 - LCEFVQ

KDEVKPAVIQLLWERATEKVPSSPLERCSSVMLLGMMAR RGKPEIVGSNLDALVRVGLDEKSPQDYRLAQQVCLAIANISDRRK PSLGERHPPFRLPQ

EHRLFERLQDMVTKG GFAHPDPLWIPFKEVAVTLTYQLAESPDVLCAQMLQGCAKQVLEKLEKNATEADPK KETAPRLPTFLLMNLLSLAGDVALQQL

VHLEQAVSGELGRRRVLREEQEHRAKEPKEK - UNI2700 - TASSETTMEEELGLVGGATADDTEAELIRSICEKELLDG GNQVLAAFVPLLLKVC

NNPGLYSNPELCAAASLALGKFCMIS SAPFCDSQLRLLFTMLEKSSLPTVRSNLMVATGDLAIRFPNLVDPWTPHLYAR RLRDPAQQVRKTAGLVMTH

LILKDMVKVKGQVSEMAVLLIDPVPQIAALAKNFFNELSHK GNAIYNLLPDIISRLSDPEGGVEEEPFHTIMK KQLLSYITKDKQTESLVEKLCQRFR

TAR RTERQYRDLAYCMSQLPLTERGLQKMLDNFECFGDKLLDESVFSAFLSVVGKLRRGAKPEGK AIIDEFEQKLRACHTRGMDGIEEFETGQGGSQR

ALSAKKPSAV - UNI14974 - VSRLQPLTSVDSDNDFVTPKPRRTKPGRPQTQQRKKSQRKAKVVFLSDESSEDE - UNI14974 - ELSAEMTE

EETPKRTTPT - UNI14974 - TLVEVLVVCGFNMEMAFALRSFS

For any suggestions or comments, please send an email to unitrap@crg.es