Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038292 (Ccdc155)
Chromosomal location
Chr 7: 52439046 - 52460262 (-)
Description
coiled-coil domain containing 155 Gene [Source:MGI Symbol;Acc:MGI:2687329]
RefSeq_dna
NM_201374 
RefSeq_peptide
NP_958762.1 
UniGene
Mm.214931 
MGI
MGI:2687329 
Uniprot/SWISSPROT
Q80VJ8 
Human Ortholog
ENSG00000161609 (CCDC155)
Omim not available
UniTrap UNI33367
Vector Insertion
Chr 7: 52455614 - 52460263
Public Clones IST10603G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042672
Sequence
GGGCGAGCCAGACCCAAAAGAAAGAACTTGGTTCAAAGACTGACAAGAAGAAAAGGATGAACAGGGAGTCCTTCGGTTGAACTCTCTCCTGCTTGGCCCT

ATTTTGTCAAGCAGAAGGAAAGGATTTTTGTACCGCAGAAGAAAGCTGCCGATAATATCGCGCCATCACCGCTAGCCCCACTAGTGCGCATGCACTCGAT

CCTCAGGTCCAGCCTATCCTCCCGAGAAGCTCTACGCATGCGCCAGCTCAAGGGTCTTCGTAAGGAGAGACCCGGGCGCCATCCACTCGGAGTGCGCTTG

C - UNI33367 - GAGCTATCTGGACATCCTTTCTTTTCCCCAACCCTCCTCACAGTGGAGGGAAGCTGAGAGCTTCGACAGCAGCTGTAGAGGAGCA

TCAGGAGTGGTCCATGGACCTGCCGGAGGGCCAGGCTGGTGGTCCAACTGCACAGA - UNI33367 - TGTACCTCTGGGAACAGCCCGAGGAAGCGA

GTTCAAGGCCACTGCTCAGCCTAGAGGAACAGATCCTTAACTCCACATTTGAAGCCTGTGACCCTCACAAGACAG GCACTGTGACTGTGGCCCACCTCC

TGGCCTACCTGGAGGCTGTGACAGGACAGGGACCTCAGGATGTGCGCCTCCAAACACTGGCCCGGAGCTTGGACCCTTATGGAGAGGGTGCTGGAGCCAC

TGTGGAACTGGACACCTTTCTGGTGGTCATGCGGGACTGGATTGCTGCCTGTCAGCTGCAGGG GGGATTAGAGCGGGCAGAGGAGACCGCCTACGAGGG

AGCCCTGGCTTCTCCACACCTGCCATCTG TGTGCCCAGAAGCTGAGGAGTCAGCCAACTTAGAGAGCTTTGGAGGAGAAGACCCCAGGCCCGAGGG GC

CTGCCACAGCTGAGCTGCTGAGCAACCTGGAGGACCTAGAGCTAAGCAACCGGCGTCTTGCTGGTGAGAATGCCAAGCTACAACGCAGTGTGGAGACTGC

GGAGGAGGGCTCTGCACGCCTAGGGGAGGAGATCACAGCCCTGCGCAAGCAGCTGCGAAG TACCCAGCAGGCCCTGCAGGTGGCCAAGGCTTTGGATGA

GGAGCTAGAGGACCTGAAGACTCTGGCCAAGAGCCTAGAGGAGCAGAATCGCAGTCTGATGGCCCAGGCCCGGCACACA GAGAAGGAGCAGCAGCACCT

GGCGGCTGAGGTAGAGACGCTACAGGAGGAG AATGAGAAGCTGCTAGCTGAGAGAGATGGAGTGAAAAGGCGGAGTGAGGAGTTGGCCACAGAGAAGGA

CGCTTTGAAG CGGCAGCTCTGTGAGTGCGAACGACTCATTTGCCAGCGTGAAGCAGTCCTCTCAGAG CGTACCCGCCATGCAGAGAGTCTGGCCCGGA

CCTTGGAGGAGTACAGAACTACCACCCAG GAACTAAGGCAAGAGATCTCAAACCTGGAGGAGCAGCTGAGTCAGAGCCAGGAAGGCCCAGAGGA GCTG

CTGGAAGGGGCTGAGGCAGGAAGAGTAGGCTGGATCATGGCCCTGCCCCCATCACTAGACTTGGAGATCCAAGCTATCCGACAG GAGCAGGATGTAGCC

AGTGCTGGCCTCTCTAGTCCTCTGTATGGAGTGTGGCAGTGGGAAGAGGTGGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCGC

AGGAGGTTGAGTTTCCCTCTGAGGACCCTGCTAGGCAACAG ACAGACTTGCAGAGAGAGCCAGTGCGTGCTCTAGAAGGAAGCAGAGCTCCATGCTTGC

G GTTGTCCAGAAGCCAGGAAGAGGAGGAAGAAGAAGAGGAGAGCTGGGTCCTG GCTGACCCTTCCAGCCCTCTGGGAACCTATCACCATAAACTTGCC

CCAGGAAGCTCTCGTGAGAG TTGCCACATTGTACCAGAGATGCACCAAGCCCTCATGCCTGTGGTGAGAGACCTGGTGCCAGTTGAGAGGTCACGGACC

CAGCACTGTCTGCATCCCCAGCACTCCCCAGGGATCAG AATCAGCCAGCACCCACTGGTCCCCACACCCGTCTTGGGCCTGCTGCTGCTGCTGCTGCTC

TCCATCCTGCTGTTCAGCCAGTCCCCGCCACCCACCTGGCCTCACCTGCAGCTCTACTACCTACAGCCGCCACCAGTGTGAGGCACCCTTCCCACCACTA

TACCTCCTCCGTCAGCATGGGACCCACATCCCTAAGTTGTGTTATGTGACCATG
Translation
 - UNI33367 - MDLPEGQAGGPTAQM - UNI33367 - MYLWEQPEEASSRPLLSLEEQILNSTFEACDPHKTG GTVTVAHLLAYLEAVTGQGP

QDVRLQTLARSLDPYGEGAGATVELDTFLVVMRDWIAACQLQG GGLERAEETAYEGALASPHLPSV VCPEAEESANLESFGGEDPRPEG GPATAELL

SNLEDLELSNRRLAGENAKLQRSVETAEEGSARLGEEITALRKQLRS STQQALQVAKALDEELEDLKTLAKSLEEQNRSLMAQARHT EKEQQHLAAEV

ETLQEE NEKLLAERDGVKRRSEELATEKDALK RQLCECERLICQREAVLSE RTRHAESLARTLEEYRTTTQ ELRQEISNLEEQLSQSQEGPEE EL

LEGAEAGRVGWIMALPPSLDLEIQAIRQ EQDVASAGLSSPLYGVWQWEEVEPEPEPEPEPEPEPEPQEVEFPSEDPARQQ TDLQREPVRALEGSRAPC

LR RLSRSQEEEEEEEESWVL ADPSSPLGTYHHKLAPGSSRES SCHIVPEMHQALMPVVRDLVPVERSRTQHCLHPQHSPGIR RISQHPLVPTPVLG

LLLLLLLSILLFSQSPPPTWPHLQLYYLQPPPV
Transcript ENSMUST00000121017
Sequence
GGGCGAGCCAGACCCAAAAGAAAGAACTTGGTTCAAAGACTGACAAGAAGAAAAGGATGAACAGGGAGTCCTTCGGTTGAACTCTCTCCTGCTTGGCCCT

ATTTTGTCAAGCAGAAGGAAAGGATTTTTGTACCGCAGAAGAAAGCTGCCGATAATATCGCGCCATCACCGCTAGCCCCACTAGTGCGCATGCACTCGAT

CCTCAGGTCCAGCCTATCCTCCCGAGAAGCTCTACGCATGCGCCAGCTCAAGGGTCTTCGTAAGGAGAGACCCGGGCGCCATCCACTCGGAGTGCGCTTG

C - UNI33367 - GAGCTATCTGGACATCCTTTCTTTTCCCCAACCCTCCTCACAGTGGAGGGAAGCTGAGAGCTTCGACAGCAGCTGTAGAGGAGCA

TCAGGAGTGGTCCATGGACCTGCCGGAGGGCCAGGCTGGTGGTCCAACTGCACAGA - UNI33367 - TGTACCTCTGGGAACAGCCCGAGGAAGCGA

GTTCAAGGCCACTGCTCAGCCTAGAGGAACAGATCCTTAACTCCACATTTGAAGCCTGTGACCCTCACAAGACAG GCACTGTGACTGTGGCCCACCTCC

TGGCCTACCTGGAGGCTGTGACAGGACAGGGACCTCAGGATGTGCGCCTCCAAACACTGGCCCGGAGCTTGGACCCTTATGGAGAGGGTGCTGGAGCCAC

TGTGGAACTGGACACCTTTCTGGTGGTCATGCGGGACTGGATTGCTGCCTGTCAGCTGCAGGG GGGATTAGAGCGGGCAGAGGAGACCGCCTACGAGGG

AGCCCTGGCTTCTCCACACCTGCCATCTG TGTGCCCAGAAGCTGAGGAGTCAGCCAACTTAGAGAGCTTTGGAGGAGAAGACCCCAGGCCCGAGGG GC

CTGCCACAGCTGAGCTGCTGAGCAACCTGGAGGACCTAGAGCTAAGCAACCGGCGTCTTGCTGGTGAGAATGCCAAGCTACAACGCAGTGTGGAGACTGC

GGAGGAGGGCTCTGCACGCCTAGGGGAGGAGATCACAGCCCTGCGCAAGCAGCTGCGAAG TACCCAGCAGGCCCTGCAGGTGGCCAAGGCTTTGGATGA

GGAGCTAGAGGACCTGAAGACTCTGGCCAAGAGCCTAGAGGAGCAGAATCGCAGTCTGATGGCCCAGGCCCGGCACACA GAGAAGGAGCAGCAGCACCT

GGCGGCTGAGGTAGAGACGCTACAGGAGGAG AATGAGAAGCTGCTAGCTGAGAGAGATGGAGTGAAAAGGCGGAGTGAGGAGTTGGCCACAGAGAAGGA

CGCTTTGAAG CGGCAGCTCTGTGAGTGCGAACGACTCATTTGCCAGCGTGAAGCAGTCCTCTCAGAG CGTACCCGCCATGCAGAGAGTCTGGCCCGGA

CCTTGGAGGAGTACAGAACTACCACCCAG GAACTAAGGCAAGAGATCTCAAACCTGGAGGAGCAGCTGAGTCAGAGCCAGGAAGGCCCAGAGGA GCTG

CTGGAAGGGGCTGAGGCAGGAAGAGTAGGCTGGATCATGGCCCTGCCCCCATCACTAGACTTGGAGATCCAAGCTATCCGACAG GAGCAGGATGTAGCC

AGTGCTGGCCTCTCTAGTCCTCTGTATGGAGTGTGGCAGTGGGAAGAGGTGGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCTGAGCCGC

AGGAGGTTGAGTTTCCCTCTGAGGACCCTGCTAGGCAACAG ACAGACTTGCAGAGAGAGCCAGTGCGTGCTCTAGAAGGAAGCAGAGCTCCATGCTTGC

G GTTGTCCAGAAGCCAGGAAGAGGAGGAAGAAGAAGAGGAGAGCTGGGTCCTG GCTGACCCTTCCAGCCCTCTGGGAACCTATCACCATAAACTTGCC

CCAGGAAGCTCTCGTGAGAG TTGCCACATTGTACCAGAGATGCACCAAGCCCTCATGCCTGTGGTGAGAGACCTGGTGCCAGTTGAGAGGTCACGGACC

CAGCACTGTCTGCATCCCCAGCACTCCCCAGGGATCAG AATCAGCCAGCACCCACTGGTCCCCACACCCGTCTTGGGCCTGCTGCTGCTGCTGCTGCTC

TCCATCCTGCTGTTCAGCCAGTCCCCGCCACCCACCTGGCCTCACCTGCAGCTCTACTACCTACAGCCGCCACCAGTGTGAGGCACCCTTCCCACCACTA

TACCTCCTCCGTCAGCATGGGACCCACATCCCTAAGTTGTGTTATGTGACCATGA
Translation
MHSILRSSLSSREALRMRQLKGLRKERPGRHPLGVRLR - UNI33367 - RAIWTSFLFPNPPHSGGKLRASTAAVEEHQEWSMDLPEGQAGGPTAQM

 - UNI33367 - MYLWEQPEEASSRPLLSLEEQILNSTFEACDPHKTG GTVTVAHLLAYLEAVTGQGPQDVRLQTLARSLDPYGEGAGATVELDTFL

VVMRDWIAACQLQG GGLERAEETAYEGALASPHLPSV VCPEAEESANLESFGGEDPRPEG GPATAELLSNLEDLELSNRRLAGENAKLQRSVETAEE

GSARLGEEITALRKQLRS STQQALQVAKALDEELEDLKTLAKSLEEQNRSLMAQARHT EKEQQHLAAEVETLQEE NEKLLAERDGVKRRSEELATEK

DALK RQLCECERLICQREAVLSE RTRHAESLARTLEEYRTTTQ ELRQEISNLEEQLSQSQEGPEE ELLEGAEAGRVGWIMALPPSLDLEIQAIRQ 

EQDVASAGLSSPLYGVWQWEEVEPEPEPEPEPEPEPEPQEVEFPSEDPARQQ TDLQREPVRALEGSRAPCLR RLSRSQEEEEEEEESWVL ADPSSPL

GTYHHKLAPGSSRES SCHIVPEMHQALMPVVRDLVPVERSRTQHCLHPQHSPGIR RISQHPLVPTPVLGLLLLLLLSILLFSQSPPPTWPHLQLYYLQ

PPPV

For any suggestions or comments, please send an email to unitrap@crg.es