Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038302 (Lace1)
Chromosomal location
Chr 10: 42032394 - 42198221 (-)
Description
lactation elevated 1 Gene [Source:MGI (curated);Acc:Lace1-001]
RefSeq_dna
NM_145743 
RefSeq_peptide
NP_665686.2 
MGI
MGI:2148801 
Uniprot/SWISSPROT
Q3V384 
Uniprot/SPTREMBL
Q8K3Z2 
Human Ortholog
ENSG00000135537 (LACE1)
Omim not available
UniTrap UNI19146
Vector Insertion
Chr 10: 42174337 - 42198068
Public Clones D155B07 (ggtc) IST10069H3 (tigm)
Private Clones OST403552 (lexicon) OST300941 (lexicon) OST287493 (lexicon) OST232580 (lexicon)
OST118821 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35842
Vector Insertion
Chr 10: 42158159 - 42174337
Public Clones IST10636H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27715
Vector Insertion
Chr 10: 42145115 - 42146291
Public Clones not available
Private Clones OST51970 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35636
Vector Insertion
Chr 10: 42135354 - 42145115
Public Clones IST15016F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31350
Vector Insertion
Chr 10: 42120146 - 42135455
Public Clones IST14099G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041024
Sequence
GTACGGAGCTCAAGATGGCGGCCTCCTGGTCGCCCTTGGTTACTCTGCGCTCCGCCGCGCGCAGCCGGCTGACTGGGAGAGGTGTTGGGTGCGGGGCGCG

GGTCGTCGCAATCCCTCCTCCGGCCCCTGGCCCTGGGAAACCCCTGTGGAAAG - UNI19146 - - UNI35842 - CCTACACAGTCCAGACATCC

GAGGGTGTACGCCCAACAGCCGCTTCTGAGGCCCGTTTGAAAGCCTTGGCTGTTTGCCACGGGCCTCTGGACCACTACGACTTTCTGATCAAATCTCAGG

AGCTGAGGGAGGATGAACATCAAAGAAGAGTCGTTCAGTGTTTGCAGAAGTTACAGGAGGACCTTAAAGGATACAGCATAGAGGAAGGAGGGCTCTTTTC

AAAG - UNI35842 - CTTTTTTCAAGGAACAAACCTCCAAAGGGCCTCTATGTTTATGGAGACGTTG - UNI35842 - GTACAGGAAAAACAAT

GGTGATGGACATGTTTTATGCATATGTGGAAACGAAGAGAAAGAAGCGGGTCCATTTTCACGGCTTCATGCTGGACGTGCACAGAA - UNI27715 - 

- UNI35636 - GGATACACCACCTTAAACAGAGTTTGCCAAAAAGGAAGGCGGGATTCATGGCTAAGTCATATGACCCGATAGCTCCCATAGCCGAGG

AAATCAGTCAAGAAACTTCTCTCCTATGTTTTGATGAATTTCAG - UNI31350 - - UNI35636 - GTCACTGACATCGCCGACGCCATGATTCT

GAAACAGCTTTTTGAAAATCTGTTCAAAAACGGGGTCGTCGTTGTGGCAACATCCAACAGACCACCGGAAG - UNI31350 - - UNI35636 - AT

CTCTATAAAAATGGACTCCAGAGGGCTAACTTTGTGCCATTTATAGCTGTCCTGAAG - UNI31350 - GAATATTGTGATACGCTCCAGCTGGATTC

TGGGGTAGATTACCGGAAAAGGGAACTCGCCCCTGCAGGAAAACTCTACTACCT CACAAGTGAGGCTGATGTGGAGGCCGTCGTGGATAAGTTGTTTGA

TGAGCTGGCTCAGAAACAAAATGATT TAACTAGCCCAAGGATTCTGAAAGTGCAAGGCAGAGAGCTGCGGCTGAATAAAGCCTGTGGAAGCGTTGCCGA

CTGCACATTTGAAGAGCTGTGTGAGAGA CCACTTGGAGCAAGTGACTATTTGGAATTATCAAAGAATTTTGATACGGTAATCATACGAAACATTCCGCA

GTTTTCACTGGCAAAGAGGACGCAAGCGAGAAGATTCATCACTCTCATTGATAACTTCTATGACTTCAAG GTGCGCATTATCTGCTCCGCTTCAGCTCC

GATCTCAAGCTTGTTTCTGCATCAGCATCAGGACAGTGAGTCGGACCAAAGCAGAATCCTGATGGATGATTTGGGGCTGAGCCAG GACTCAGCCGGGCT

CTCCATGTTTACGGGGGAGGAGGAAATCTTCGCCTTTCAGCGCACCATTTCCCGGCTCACAGAGATGCAGACGGAGCAGTACTGGATTGAAGGGGACAGA

AGCAGGAAGTAACTGCCACTTTGACAAGATTAAAAGGAAAAGGTGACTGGTTAGGGCTGCGAGACAGTGAGATGTCACTGCGAGACGTCACTGCGTCACC

GAGACGTGACGGGGATCATTTCGTCATCATCAATGCACTTTGCCCTCTGGACTGCTGCGTCTGTGGCAGTGGATGGACACACTGAAGAATTCTGTCTCCT

TTGTAGATCCGAGTTTATTTATAAAGTGGAATCATCACTCTTGAAGATTACTGCAAACCCTGACATGTGTGCGCTGTCTGAATCATGAACGCACAGGCAG

AGTATGCAGGATGTCTGTGCACCTCCCAGCTTCGGCTGCACAGTAGTCACACTGTAGAAATACATTCGCTGTAAGAAACAAGTGGCATCCTACTGTTCAG

GTTAAAACAAAGAAAGCCTTCTGAACATAACTGAAGGGAAAAGCACTTTACGTTGGCCTCTGTATTCCTGTCAGTTAGTTGGTTAGGAATGGCAATAACC

TTTGGGCCTCAAGGTTTCCTCAGCTCTAGAAAGAACACGTGTCTAACCAGCAGATCCAGGTTAGCAGGCAGTGCCTGAGCCCATGAGGACATAGGTTATA

AAGCCATCAGGTAAGGAGCAAGTAGAAAATTCCAGCTGATTGGCAGGTCTCCCCTCTGACAGACAGCCAAAATGGGGCAGGTTCCAGGATCCTGATTGGT

CGAGTGCTGGAGGAGGCAGAGCCAGAGCCACACCCACAGGAGCATGGACCATCCCTCCCTCCCCCCATCACCCAAGGTTTCCACTCTGTTCACTAGCTTC

TGCTTGCACTACAGAGTCCACTCCCTGTCCTTGATCCTGAGTCACAGAGTTGGGCCTTGTAGGAAACTGGAAGGACACTTGATAAATCTTCTATAAATAA

AAGTTGGTTTCTCCT
Translation
MAASWSPLVTLRSAARSRLTGRGVGCGARVVAIPPPAPGPGKPLWKA - UNI19146 - - UNI35842 - AYTVQTSEGVRPTAASEARLKALAVC

HGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSK - UNI35842 - LFSRNKPPKGLYVYGDVG - UNI35842 - GTGKT

MVMDMFYAYVETKRKKRVHFHGFMLDVHRR - UNI27715 - - UNI35636 - RIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEF

Q - UNI31350 - - UNI35636 - VTDIADAMILKQLFENLFKNGVVVVATSNRPPED - UNI31350 - - UNI35636 - DLYKNGLQRAN

FVPFIAVLK - UNI31350 - EYCDTLQLDSGVDYRKRELAPAGKLYYL LTSEADVEAVVDKLFDELAQKQNDL LTSPRILKVQGRELRLNKACGS

VADCTFEELCER PLGASDYLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFK VRIICSASAPISSLFLHQHQDSESDQSRILMDDLGLSQ 

DSAGLSMFTGEEEIFAFQRTISRLTEMQTEQYWIEGDRSRK

For any suggestions or comments, please send an email to unitrap@crg.es