Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038312 (Edem2)
Chromosomal location
Chr 2: 155527761 - 155555146 (-)
Description
ER degradation enhancer, mannosidase alpha-like 2 Gene [Source:MGI (curated);Acc:Edem2-001]
RefSeq_dna
NM_145537 
RefSeq_peptide
NP_663512.1 
UniGene
Mm.273706 Mm.406959 
MGI
MGI:1915540 
Uniprot/SPTREMBL
Q8BJR2 Q8BJT9 Q8BK85 Q91VV3 
Human Ortholog
ENSG00000088298 (EDEM2)
Omim not available
UniTrap UNI11379
Vector Insertion
Chr 2: 155544126 - 155548167
Public Clones G009D11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37276
Vector Insertion
Chr 2: 155528329 - 155531390
Public Clones CMHD-GT_492B2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040833
Sequence
AGCCGCGGCTCGGAGGATGAGCTGGTGGCGGTGGCTGCAGCTGCTGCGGCGGCACTGACAGGACACGAGCTCTATGCCTTTCCGGCTACTCATCCCGCTC

GGCCTCGTGTGCGTGCTGCTACCCCTGCACCATGGTGCGCCAGGCCCCGACGGCACCGCGCCCGACCCCGCCCACTACAG GGAGCGAGTCAAGGCCATG

TTCTACCACGCCTACGACAGTTACCTGGAAAATGCCTTTCCCTACGATGAGCTGAGACCTCTCACCTGTGATGGGCACGACACCTGGGGCAG TTTTTCT

CTGACGCTAATTGATGCCCTGGACACCTTGCTG ATTTTGGGGAATACCTCTGAATTCCAAAGAGTAGTGGAGGTTCTTCAGGACAATGTGGACTTTGAT

ATCGACGTGAACGCCTCTGTGTTCGAAACCAACATCCGAG - UNI11379 - TGGTAGGAGGACTCCTTTCTGCTCATCTCTTGTCAAAGAAGGCCGG

TGTGGAGGTGGAAGCCGGGTGGCCTTGTTCTGGGCCTCTCCTCAGGATGGCGGAGGAAGCAGCCCGGAAACTCCTCCCAG CATTTCAGACCCCCACGGG

CATGCCCTATGGAACTGTGAACCTGCTTCATGGCGTGAACCCTGGAGAGACCCCTGTTACCTGTACAGCAGGGATTGGGACCTTCATTGTGGAATTTGCT

ACCCTGAGCAGCCTCACCGGTGACCCTGTGTTTGAAGATGTGGCCAGAGTGGCCCTGATGCGTCTCTGGGAGAGCCGGTCAGATATCGGGCTG GTTGGC

AATCACATCGATGTGCTCACTGGCAAGTGGGTGGCCCAGGATGCAGGCATCGGGGCTGGTGTGGATTCCTATTTTGAGTACCTGGTAAAAGGAGCCATCC

TTCTTCAGGATAAGAAACTCATGGCCATGTTCCTAG AGTACAACAAAGCCATCCGGAATTACACGCACTTCGATGACTGGTACCTCTGGGTGCAGATGT

ACAAGGGGACCGTGTCAATGCCTGTCTTCCAGTCCTTGGAGGCCTACTGGCCTGGCCTTCAG AGCCTTATTGGAGACATTGACAATGCCATGAGGACCT

TTCTCAACTACTACACTGTATGGAAGCAGTTTGGGGGGCTGCCAGAATTCTACAACATTCCTCAGGGATACACAGTGGAGAAGCGAGAAGGCTACCCACT

CCGACCGG AGCTCATCGAGAGCGCAATGTACCTCTACCGCGCCACTGGGGATCCCACTCTCTTAGAACTTGGGAGAGACGCTGTGGAATCCATTGAGAA

AATCAGCAAGGTGGAGTGTGGATTTGCCACG - UNI37276 - ATCAAGGACCTCCGGGACCACAAGCTTGACAACCGCATGGAGTCTTTCTTCCTGG

CTGAAACTGTGAAATACCTCTATCTTCTGTTCCACCCAAACAACTTCATCCACAACAATGGCTCCACCTTTGACTCTGTGATGACTCCCCATGGGGAGTG

CATCCTAGGAGCCGGGGGCTACATCTTCAACACGGAGGCTCACCCCATTGACCCTGCTGCCTTGCACTGCTGCCGGAGGCTCAAGGAGGAGCAGTGGGAA

GTGGAGGACTTGATAAAGGAGTTCTACTCCCTCAAACAGAGCAGGCCAAAGAGAGCTCAGAGGAAGACAGTGAGGTCGGGGCCCTGGGAGCCCCAGTCAG

GGCCAGCCACGCTCTCCTCACCTGCAAACCAGCCCAGGGAGAAGCAGCCTGCCCAGCAGCGAACCCCGCTTCTCAGCTGCCCCAGCCAGCCCTTCACCTC

TAAGCTGGCATTGCTAGGCCAGGTTTTCCTAGACTCCTCATAGCCACTGGATAATTTTCTAATTTTTATTTTTTTGAGACTAAGCTCTAATAATAAATCT

GCTTTTGGCTATC
Translation
MPFRLLIPLGLVCVLLPLHHGAPGPDGTAPDPAHYR RERVKAMFYHAYDSYLENAFPYDELRPLTCDGHDTWGS SFSLTLIDALDTLL ILGNTSEFQ

RVVEVLQDNVDFDIDVNASVFETNIRV - UNI11379 - VVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPA AFQTPTGMPYGTVNL

LHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGL VGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLM

AMFLE EYNKAIRNYTHFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQ SLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYTVEKREGYPLRPE E

LIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFAT - UNI37276 - IKDLRDHKLDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDSVM

TPHGECILGAGGYIFNTEAHPIDPAALHCCRRLKEEQWEVEDLIKEFYSLKQSRPKRAQRKTVRSGPWEPQSGPATLSSPANQPREKQPAQQRTPLLSCP

SQPFTSKLALLGQVFLDSS

For any suggestions or comments, please send an email to unitrap@crg.es