Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038319 (Kcnh2)
Chromosomal location
Chr 5: 23825408 - 23857422 (-)
Description
potassium voltage-gated channel, subfamily H (eag-related), member 2 Gene [Source:MGI (curated);Acc:Kcnh2-001]
RefSeq_dna
NM_013569 
RefSeq_peptide
NP_038597.2 
UniGene
Mm.6539 
MGI
MGI:1341722 
Uniprot/SWISSPROT
O35219 
Uniprot/SPTREMBL
Q80WG1 Q53Z09 Q80XE8 
Human Ortholog
ENSG00000055118 (KCNH2)
Omim 152427 - POTASSIUM CHANNEL, VOLTAGE-GATED, SUBFAMILY H, MEMBER 2  609620 - SHORT QT SYNDROME 1  
UniTrap UNI34953
Vector Insertion
Chr 5: 23854128 - 23857423
Public Clones IST12862D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18751
Vector Insertion
Chr 5: 23825968 - 23827062
Public Clones not available
Private Clones OST415081 (lexicon) OST376848 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115098
Sequence
ATGGCGATTCCAGCCGGGAAGGAGAGCAGGACAGGGGCTCTGCAGCCCAGGGCCCAGAAAGGCCGGGTGAGGCGGGCAGTGCGCATCTCCAGCCTGGTGG

CCCAGGAG GTCCTGTCCTTGGGAGCAGATGTGCTGCCTGAGTATAAGCTGCAGGCCCCAAGAATCCACCGCTGGACCATCCTCCACTACAGCCCCTTCA

AGGCGGTGTGGGACTGGCTCATCCTGCTGCTGGTCATCTACACGGCAGTCTTCACACCGTACTCGGCCGCCTTCCTGCTGAAGGAGACTGAAGATGGGTC

CCAAGCCCCTGACTGTGGCTACGCCTGCCAGCCCCTGGCTGTAGTGGACCTCATCGTGGACATCATGTTCATTGTGGACATCCTTATCAATTTCCGTACC

ACCTATGTTAATGCCAACGAGGAGGTGGTTAGCCATCCTGGCCGCATTGCTGTGCACTACTTCAAGGGCTGGTTTCTCATTGACATGGTGGCTGCCATCC

CCTTCGACCTGCTCATCTTTGGCTCTGGCTCCGAGGAG CTGATCGGGCTGCTGAAAACTGCGAGGCTGCTGCGGCTGGTGCGCGTGGCTCGGAAGCTGG

ACCGCTACTCGGAGTACGGGGCAGCAGTGCTCTTCCTGCTCATGTGCACCTTCGCCCTCATTGCGCACTGGTTGGCCTGCATCTGGTACGCGATCGGCAA

CATGGAACAGCCTCACATGGACTCACACATCGGCTGGCTGCACAACTTGGGCGACCAGATCGGCAAGCCCTACAACAGCAGCGGCCTGGGAGGCCCCTCC

ATCAAGGACAAGTATGTCACAGCGCTCTACTTCACCTTCAGCAGCCTCACCAGCGTGGGCTTTGGCAATGTCTCTCCCAACACCAACTCAGAGAAGATCT

TCTCCATCTGTGTCATGCTCATTGGCT CCCTCATGTATGCCAGCATCTTCGGCAACGTGTCCGCCATCATCCAGCGGCTGTACTCGGGCACGGCCCGCT

ACCACACACAGATGCTCCGGGTGCGGGAGTTTATCCGCTTTCACCAGATTCCCAACCCATTACGCCAGCGCCTCGAGGAGTACTTCCAGCATGCTTGGTC

CTACACCAATGGCATCGACATGAACGCG GTGCTGAAGGGCTTCCCTGAGTGCCTCCAGGCTGACATCTGCCTACACCTGAACCGCTCGCTGCTGCAGCA

TTGCAAGCCATTCCGAGGGGCCACTAAAGGCTGCCTGAGGGCGCTGGCTATGAAGTTCAAGACCACACATGCACCACCAGGGGACACACTAGTGCACGCC

GGGGACCTGCTTACTGCCCTCTACTTCATCTCCAGGGGCTCCATCGAGATCCTGCGGGGTGATGTCGTGGTGGCCATCTTGG GGAAGAACGACATCTTT

GGAGAGCCTCTGAACCTATATGCCCGTCCTGGAAAGTCCAATGGGGATGTGCGGGCCCTCACGTACTGTGACCTGCACAAGATCCATCGTGATGACTTGC

TGGAGGTGTTGGACATGTATCCCGAGTTCTCAGATCACTTTTGGTCTAGCCTGGAGATCACCTTCAACCTTCGAGAT ACCAACATGATTCCTGGCTCCC

CAGGCAGTGCAGAACTAGAGAGCGGCTTTAACAGGCAACGCAAGCGCAAACTGTCATTCCGCAGGCGTACAGACAAGG ACACAGAGCAGCCAGGGGAGG

TGTCAGCCCTGGGGCAAGGCCCTGCCCGAGTTGGGCCAGGGCCGAGTTGCCGGGGACAGCCGGGAGGGCCATGGGGGGAGAGCCCATCCAGCGGCCCTTC

CAGCCCAGAGAGCAGTGAAGATGAGGGCCCTGGTCGCAGCTCCAGTCCCCTCCGCCTGGTGCCCTTCTCCAGCCCCAGGCCTCCGGGAGACCCCCCAGGT

GGGGAGCCTTTGACAGAGGATGGGGAGAAAAGTGACACCTGTAATCCCTTGTCAG GTGCCTTCTCTGGGGTGTCCAATATTTTCAGCTTCTGGGGGGAC

AGTCGGGGGCGCCAGTACCAGGAGTTGCCTCGATGCCCTGCCCCTGCCCCCAGCCTCCTCAACATCCCCTTGTCTAGCCCTGGTCGGCGATCCCGGGGTG

ATGTGGAGAGCAGGCTGGACGCACTCCAGAGACAGCTGAACAG GCTGGAAACCCGGCTAAGTGCAGACATGGCCACTGTCCTACAGCTGCTACAGAGGC

AAATGACCCTGGTCCCTCCTGCCTACAGTGCTGTGACCACCCCTGGGCCCGGCCCCACTTCCGCATCCCCTTTGTTGCCTGTCGGCCCTGTCCCCACTCT

CACCCTGGACTCGCTTTCTCAG - UNI18751 - GTTTCCCAGTTCGTGGCGTTTGAGGAGCTTCCTGCAGGAGCCCCAGAGCTCCCCCAAGATGGCC

CCACTCGACGCCTCTCCCTGCCCGGCCAGCTGGGGGCCCTTACCTCCCAGCCCCTGCACAGACATGGCTCAGATCCAGGCAGTTAGTGATGCTGCCCACT

GTGGACATGTGGCTCACCCTGGGTTCAGGGCATTACCTGACCGCTCTCCTTGGAGACCCTGGTTTGGAGGGGAGACCTGTGCAGAAGCACCTCCATCCCC

ACCCTTGGGACCAGCATCTCCTCCTGCAATACCCTGGGCCCCACTGGGAGGGGCAGGACAGAGCTGGGCAGTGGATGGGGGTCTGTGGTCCCCCCACTGC

CCTGGGGGCATTAGCTGGTCTAACTGCCCGGAGGCACCGGCCCTGGGCCTTAGGCACCTCAAGGACTTTTCTGCTATTTACTGCTCTTATTGTTAAGGAT

AATAATTAAGGATCATATGAATAATTAATGAAGATGCTGATGACTATGAATAATAAATAATTATCCTGAGGAGACTCCAGGGTGCTGGTTAGCTTC
Translation
MAIPAGKESRTGALQPRAQKGRVRRAVRISSLVAQE VLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEDG

SQAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEE LIGLLKTARLLRLVRVARK

LDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSHIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEK

IFSICVMLIGS SLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNA VLKGFPECLQADICLHLNRS

LLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILG GKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKI

HRDDLLEVLDMYPEFSDHFWSSLEITFNLRD TNMIPGSPGSAELESGFNRQRKRKLSFRRRTDKD DTEQPGEVSALGQGPARVGPGPSCRGQPGGPWG

ESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGDPPGGEPLTEDGEKSDTCNPLSG GAFSGVSNIFSFWGDSRGRQYQELPRCPAPAPSLLNIPL

SSPGRRSRGDVESRLDALQRQLNR RLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSASPLLPVGPVPTLTLDSLSQ - UNI18751 - V

SQFVAFEELPAGAPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Transcript ENSMUST00000036092
Sequence
CCGGGAGCCCGGCGCTGGAGCGGGCGGAGCGCGGCGCGGGGACGAGGTGCAGCCGGGCCCGTGGCACCACCAGCCCGGGTCGACAGACAGGTGTGCCGGC

GCCGCAGCTCCAGCAGCTTCAGGCCCGGCCCAGGGTCCGGAGCCGGCAGCCACTAAGCAGAGCGGGAATCCCGCGCCCTCGGTCCAGTTCCGGCCCCGCC

CGCACTCAGCTTGGCCGCGGGGTGCGGAGACCACGGCCCGGCCAGGCCACCCGAAGCCTAGTGCTGGGCCGGGCCGGGCCAGGGTGGGTGGGGGCCCGCC

CGGCCCGCCCATGGGCTCAGGATGCCGGTGCGGAGGGGCCACGTCGCGCCGCAGAACACCTTCCTCGACACCATCATCCGCAAGTTTGAGGGCCAGA - 

UNI34953 - GCCGCAAGTTCATCATCGCTAACGCGCGCGTAGAGAACTGCGCTGTCATCTACTGCAACGACGGCTTCTGCGAACTGTGTGGCTACTCG

CGGGCCGAGGTGATGCAGCGGCCCTGCACCTGCGATTTCCTGCATGGGCCGCGCACGCAGCGCCGTGCCGCCGCGCAGATCGCGCAGGCCCTGCTGGGCG

CAGAGGAGCGCAAAGTGGAGATCGCCTTCTACCGGAAAGATG - UNI34953 - GGAGCTGCTTCCTGTGTCTGGTGGATGTGGTACCCGTGAAGAAT

GAAGATGGGGCTGTGATCATGTTCATCCTCAACTTTGAAGTAGTGATGGAGAAGGACATGGTAGGGTCCCCGGCTCATGACACCAACCACAGGGGCCCCT

CTACCAGCTGGCTAGCTTCTG GCCGGGCCAAGACTTTCCGCCTGAAGCTGCCTGCCTTGTTGGCACTGACGGCCAGGGAATCATCTGTGCGGACAGGAA

GCATGCGCAGTGCTGGAGCCCCTGGGGCGGTGGTGGTGGATGTGGACCTGACGCCGGCAGCACCCAGCAGTGAGTCCCTGGCCTTGGATGAGGTTTCTGC

CATGGACAACCATGTGGCAGGGCTTGGGCCTGCAGAAGAGAGGCGAGCACTGGTGGGCCCGGGGTCTGCTTCACCAGTAGCCAGCATCCGAGGCCCTCAC

CCATCGCCACGAGCTCAGAGCCTTAACCCTGATGCCTCAGGTTCCAGCTGCAGCCTGGCCCGGACACGCTCCCGTGAGAGCTGCGCTAGCGTGCGCCGCG

CATCATCCGCGGATGACATTGAGGCAATGCGGGCTGGAGCGCTGCCCCCTCCGCCCCGCCATGCAAGCACAG GGGCCATGCACCCCCTGCGCAGTGGCC

TGCTTAACTCCACCTCAGACTCTGACCTTGTACGCTACCGAACCATTAGCAAGATACCCCAAATCACTCTCAACTTTGTGGACCTCAAAGGCGACCCTTT

CCTGGCTTCACCCACCAGTGACCGGGAGATTATAGCACCCAAGATAAAAGAGCGGACCCACAATGTCACCGAGAAGGTCACCCAG GTCCTGTCCTTGGG

AGCAGATGTGCTGCCTGAGTATAAGCTGCAGGCCCCAAGAATCCACCGCTGGACCATCCTCCACTACAGCCCCTTCAAGGCGGTGTGGGACTGGCTCATC

CTGCTGCTGGTCATCTACACGGCAGTCTTCACACCGTACTCGGCCGCCTTCCTGCTGAAGGAGACTGAAGATGGGTCCCAAGCCCCTGACTGTGGCTACG

CCTGCCAGCCCCTGGCTGTAGTGGACCTCATCGTGGACATCATGTTCATTGTGGACATCCTTATCAATTTCCGTACCACCTATGTTAATGCCAACGAGGA

GGTGGTTAGCCATCCTGGCCGCATTGCTGTGCACTACTTCAAGGGCTGGTTTCTCATTGACATGGTGGCTGCCATCCCCTTCGACCTGCTCATCTTTGGC

TCTGGCTCCGAGGAG CTGATCGGGCTGCTGAAAACTGCGAGGCTGCTGCGGCTGGTGCGCGTGGCTCGGAAGCTGGACCGCTACTCGGAGTACGGGGCA

GCAGTGCTCTTCCTGCTCATGTGCACCTTCGCCCTCATTGCGCACTGGTTGGCCTGCATCTGGTACGCGATCGGCAACATGGAACAGCCTCACATGGACT

CACACATCGGCTGGCTGCACAACTTGGGCGACCAGATCGGCAAGCCCTACAACAGCAGCGGCCTGGGAGGCCCCTCCATCAAGGACAAGTATGTCACAGC

GCTCTACTTCACCTTCAGCAGCCTCACCAGCGTGGGCTTTGGCAATGTCTCTCCCAACACCAACTCAGAGAAGATCTTCTCCATCTGTGTCATGCTCATT

GGCT CCCTCATGTATGCCAGCATCTTCGGCAACGTGTCCGCCATCATCCAGCGGCTGTACTCGGGCACGGCCCGCTACCACACACAGATGCTCCGGGTG

CGGGAGTTTATCCGCTTTCACCAGATTCCCAACCCATTACGCCAGCGCCTCGAGGAGTACTTCCAGCATGCTTGGTCCTACACCAATGGCATCGACATGA

ACGCG GTGCTGAAGGGCTTCCCTGAGTGCCTCCAGGCTGACATCTGCCTACACCTGAACCGCTCGCTGCTGCAGCATTGCAAGCCATTCCGAGGGGCCA

CTAAAGGCTGCCTGAGGGCGCTGGCTATGAAGTTCAAGACCACACATGCACCACCAGGGGACACACTAGTGCACGCCGGGGACCTGCTTACTGCCCTCTA

CTTCATCTCCAGGGGCTCCATCGAGATCCTGCGGGGTGATGTCGTGGTGGCCATCTTGG GGAAGAACGACATCTTTGGAGAGCCTCTGAACCTATATGC

CCGTCCTGGAAAGTCCAATGGGGATGTGCGGGCCCTCACGTACTGTGACCTGCACAAGATCCATCGTGATGACTTGCTGGAGGTGTTGGACATGTATCCC

GAGTTCTCAGATCACTTTTGGTCTAGCCTGGAGATCACCTTCAACCTTCGAGAT ACCAACATGATTCCTGGCTCCCCAGGCAGTGCAGAACTAGAGAGC

GGCTTTAACAGGCAACGCAAGCGCAAACTGTCATTCCGCAGGCGTACAGACAAGG ACACAGAGCAGCCAGGGGAGGTGTCAGCCCTGGGGCAAGGCCCT

GCCCGAGTTGGGCCAGGGCCGAGTTGCCGGGGACAGCCGGGAGGGCCATGGGGGGAGAGCCCATCCAGCGGCCCTTCCAGCCCAGAGAGCAGTGAAGATG

AGGGCCCTGGTCGCAGCTCCAGTCCCCTCCGCCTGGTGCCCTTCTCCAGCCCCAGGCCTCCGGGAGACCCCCCAGGTGGGGAGCCTTTGACAGAGGATGG

GGAGAAAAGTGACACCTGTAATCCCTTGTCAG GTGCCTTCTCTGGGGTGTCCAATATTTTCAGCTTCTGGGGGGACAGTCGGGGGCGCCAGTACCAGGA

GTTGCCTCGATGCCCTGCCCCTGCCCCCAGCCTCCTCAACATCCCCTTGTCTAGCCCTGGTCGGCGATCCCGGGGTGATGTGGAGAGCAGGCTGGACGCA

CTCCAGAGACAGCTGAACAG GCTGGAAACCCGGCTAAGTGCAGACATGGCCACTGTCCTACAGCTGCTACAGAGGCAAATGACCCTGGTCCCTCCTGCC

TACAGTGCTGTGACCACCCCTGGGCCCGGCCCCACTTCCGCATCCCCTTTGTTGCCTGTCGGCCCTGTCCCCACTCTCACCCTGGACTCGCTTTCTCAG 

- UNI18751 - GTTTCCCAGTTCGTGGCGTTTGAGGAGCTTCCTGCAGGAGCCCCAGAGCTCCCCCAAGATGGCCCCACTCGACGCCTCTCCCTGCCC

GGCCAGCTGGGGGCCCTTACCTCCCAGCCCCTGCACAGACATGGCTCAGATCCAGGCAGTTAGTGATGCTGCCCACTGTGGACATGTGGCTCACCCTGGG

TTCAGGGCATTACCTGACCGCTCTCCTTGGAGACCCTGGTTTGGAGGGGAGACCTGTGCAGAAGCACCTCCATCCCCACCCTTGGGACCAGCATCTCCTC

CTGCAATACCCTGGGCCCCACTGGGAGGGGCAGGACAGAGCTGGGCAGTGGATGGGGGTCTGTGGTCCCCCCACTGCCCTGGGGGCATTAGCTGGTCTAA

CTGCCCGGAGGCACCGGCCCTGGGCCTTAGGCACCTCAAGGACTTTTCTGCTATTTACTGCTCTTATTGTTAAGGATAATAATTAAGGATCATATGAATA

ATTAATGAAGATGCTGATGACTATGAATAATAAATAATTATCCTGAGGAGACTCCAGGGTGCTGGTTAGCTTC
Translation
MPVRRGHVAPQNTFLDTIIRKFEGQS - UNI34953 - SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQA

LLGAEERKVEIAFYRKDG - UNI34953 - GSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPSTSWLASG GRAKTFRLKLP

ALLALTARESSVRTGSMRSAGAPGAVVVDVDLTPAAPSSESLALDEVSAMDNHVAGLGPAEERRALVGPGSASPVASIRGPHPSPRAQSLNPDASGSSCS

LARTRSRESCASVRRASSADDIEAMRAGALPPPPRHASTG GAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIK

ERTHNVTEKVTQ VLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEDGSQAPDCGYACQPLAVVDLIVDIMF

IVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEE LIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAH

WLACIWYAIGNMEQPHMDSHIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGS SLMYASIFGNVS

AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNA VLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFK

TTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILG GKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLE

ITFNLRD TNMIPGSPGSAELESGFNRQRKRKLSFRRRTDKD DTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPESSEDEGPGRSSSP

LRLVPFSSPRPPGDPPGGEPLTEDGEKSDTCNPLSG GAFSGVSNIFSFWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRSRGDVESRLDALQRQLNR

 RLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSASPLLPVGPVPTLTLDSLSQ - UNI18751 - VSQFVAFEELPAGAPELPQDGPTRR

LSLPGQLGALTSQPLHRHGSDPGS

For any suggestions or comments, please send an email to unitrap@crg.es