Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038324 (Trpc4ap)
Chromosomal location
Chr 2: 155460046 - 155518057 (-)
Description
transient receptor potential cation channel, subfamily C, member 4 associated protein Gene [Source:MGI (curated);Acc:Trpc4ap-002]
RefSeq_dna
NM_019828 
RefSeq_peptide
NP_062802.1 
MGI
MGI:1930751 
Uniprot/SWISSPROT
Q9JLV2 
Uniprot/SPTREMBL
Q3TB80 Q3TDP6 Q3TNI0 Q3U4F7 Q3US52 Q571F0 A2AQP2 
Human Ortholog
ENSG00000100991 (TRPC4AP)
Omim not available
UniTrap UNI2545
Vector Insertion
Chr 2: 155498855 - 155517874
Public Clones XS0479 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13213
Vector Insertion
Chr 2: 155496893 - 155498725
Public Clones CMHD-GT_298A7-3 (cmhd) CMHD-GT_334H7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5400
Vector Insertion
Chr 2: 155494206 - 155496775
Public Clones RRJ115 (baygenomics) CSJ090 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041059
Sequence
GTCGGACGAGGAGACATGGCGGCAGCGCCCGCAGCGGCTGGAGCTGGGGCCAGCCGGGGGAGGCGGTTGGCAGCTACCGCGGCGGCGTGGGGCGGCTGGG

GAGGTCGACCGCGGCCGGGTAACATCCTGCTGCAGCTGCGGCAGGGCCAGCTCACCGGCCGAGGCCTGGTCCGGGCGGTGCAG - UNI2545 - TTCA

CTGAGACCTTTTTGACCGAGAGGGACAAATTGTCCAAATGGAGTGGAATTCCTCAGTTGCTCCTTAAGCTGTATGCCACCAGCCATCTGCACAGTGACTT

CGTTGAGTGCCAAAGCATTCTCAAG - UNI13213 - GAGATTTCTCCTCTTCTCTCTATGGAGGCTATGGCGTTTGTAACTGAAGACAGGAAATTTA

CTCAAGAAGCTACATACCCAAATACATATATTTTTGACTTATTTGGAGGTGTTGAT - UNI5400 - CTTCTTGTAGAAATTCTTATGAGGCCTACCA

TCTCTATCCGGGGACAGAAACTAAAAA TAAGTGACGAGATGTCGAAGGACTGCTTGAGCATCCTGTACAATACCTGTGTCTGC ACGGAAGGAGTAACG

AAGCGTTTGGCAGAAAAGAATGATTTTGTGATTTTTCTGTTCACACTGATGACAAGTAAGAAGACATTCTTACAAACAGCGACTCTCATTGAAGACATTT

TGGGTGTTAAGAAG GAAATGATCCGGCTAGATGAAGTTCCCAATCTGAGTTCCTTAGTATCCAATTTCGATCAGCAGCAGCTTGCTAACTTCTGCAGGA

TCCTGGCTGTCACCATTTCAGAGATGGACACGGGGAATGACGACAAACACACGCTTCTTGCCAAAAATGCTCAGCAGAAGAAGAGTTTGAGTTTGGGGCC

TTCTGCAGCTGAAATCAACCAAG CTGCTCTTCTCAGCATCCCTGGCTTTGTGGAACGGCTTTGCAAACTGGCAACTAGGAAAGTGTCAGAGTCAACGGG

CACAGCCAGCTTCCTTCAAGAACTGGAGGAGTGGTACACATGGCTCGACAATGCGTTGGTGCTAGATGCCCTGATGCGAGTGGCCAATGAGGAGTCTGAA

CACAATCAAG CCCCCACTGTGTTCCCTTCTCTAGGCACTTCGGAGGAGGGTGGGCTGCCACACACCTCGGCCAGGGCGCAGCTGCCCCAGTCCATGAAG

ATTATGCATGAGATTATGTACAAACTGGAAGTGCTTTATGTCCTCTGCGTGCTGCTGATGGGGCGTCAGCGAAACCAG GTCCACAGGATGATTGCTGAG

TTCAAGTTGATCCCAGGACTCAATAATTTGTTCGACAAACTGATTTGGAGGAAGCATTCAGCATCTGCCCTTGTCCTCCATGGCCACAACCAGAACTGTG

ACTGTAGCCCG GACATCACCTTGAAGATCCAGTTTTTGAGACTTCTCCAGAGTTTCAGTGACCACCATGA GAACAAGTACTTGCTGCTCAACAACCAG

GAGCTAAATGAGCTCAGTGCCATCTCGCTGAAAGCCAACATCCCTGAGGTGGAGGCTGTCCTCAACACTGACAG GAGTCTGGTGTGTGACGGCAAGAGG

GGCCTACTAACTCGGCTGCTGCAGGTCATGAAGAAGGAGCCAGCGGAGTCTTCATTCAG GTTTTGGCAAGCCCGGGCTGTGGAAAGTTTCCTCCGAGGG

ACCACCTCCTATGCAGACCAGATGTTCCTGCTGAAGCGAGGCCTTCTGGAG CACATCTTATACTGCATTGTGGACAGTGAGTGCAAGTCTAGGGATGTA

CTCCAGAGCTACTTTGATCTCCTGGGAGAGCTGATGAAGTTCAACGTCGATGCATTCAAGAGATTCAATAAATATATCAACACTGATGCAAAG TTCCAG

GTGTTCCTGAAACAGATCAACAGCTCGCTAGTGGACTCCAACATGCTGGTGCGCTGTGTCACTCTGTCACTGGACCGATTTGAAAACCAGGTGGACATGA

AAG TGGCCGAGGTCCTGTCCGAGTGCCGCCTGCTTGCCTACATATCCCAGGTGCCCACGCAAATGTCCTTCCTCTTCCGCCTCATCAATATCATCCATG

TGCAGACGCTAACCCAG GAGAACGTCAGCTGCCTCAACACCAGCCTGGTAATCCTGATGCTGGCCCGACGGAAAGAGCGGCTGCCCCTGTACCTGCGAC

TGCTACAGCGAATGGAGCACAGCAAGAAATACCCCGGCTTCCTGCTCAACAACTTCCACAACCTGCTGCGCTTTTGGCAGCAGCACTACCTGCACAAGGA

TAAGGACAGCACCTGCCTGGAGAAT AGCTCCTGTATCAGCTTCTCGTACTGGAAGGAGACAGTGTCCATCTTGTTGAACCCAGACCGCCAGTCGCCCTC

TGCCCTCGTCAGCTACATTGAGGAGCCCTACATGGACATAGACAGAGACTTCACTGAGGAGTGACCTTGAGCCAGGCTTCAAGAAGCTGCCAGGCAGGGG

CGAGTGCAGAGAGCCAGAGTGCACGTGCCGCCTCGCACTCTGCCCATCCCTGTCCCTCTTGCCTCCCCAGTGCTCTGTCCACCCCGGGTGTCCAGGTGCA

GGCTCAGTGGAAGGAACATCCTAGAAGCTCTTGTCTCCTGGGTCTGAGGGCCCAGGTCATGGGGAGCCTGTTTCTTCACTGTCCCCAGGGTAAGGACAAT

GGCACCATGCCCACCTTTCCCTCGCAATCCTGGAGCCCTGGCCTGCCAGAGAAGGGGAACACGGGAAACCATCTGTCTGAGCTTCTCCCATCAGTCCTGA

TGGAGAGGAAGATGCAGACCCCTGTGAGCCAAACCTCCCTGGCCTCAGGACGCAGGCAGAGAGGCTCCTGAGCCCTGGGCAGGGGTGGGTATCGGAGAAT

GCTGCCTTCCCCGGGGTCTGCCCATCTCTCCCTTCCTCACCTCCCTTGTCTTCCTTTAGCTCCTCTGGTTCTTTGCTCATTGGCCACTGTGTTCATCCAG

GAGGCTCCCTAGAAGTGGGGGGAGCCTTTTCTCTCCATCCCTTGGGGCATGGAGTGCCTGTGCCTGCCTGAGCCCAGACACGGGAGCCTGGCTGAGAGCT

TACCCTTGGCTCCTCCTGTGTTGCCAGTTTATTAACAGCAAATAAACCGATTAAATG
Translation
MAAAPAAAGAGASRGRRLAATAAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQ - UNI2545 - FTETFLTERDKLSKWSGIPQLLLKLYATSHL

HSDFVECQSILK - UNI13213 - EISPLLSMEAMAFVTEDRKFTQEATYPNTYIFDLFGGVD - UNI5400 - LLVEILMRPTISIRGQKLKI I

SDEMSKDCLSILYNTCVC TEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKK EMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEM

DTGNDDKHTLLAKNAQQKKSLSLGPSAAEINQA AALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQA AP

TVFPSLGTSEEGGLPHTSARAQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQ VHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSP 

DITLKIQFLRLLQSFSDHHE ENKYLLLNNQELNELSAISLKANIPEVEAVLNTDR RSLVCDGKRGLLTRLLQVMKKEPAESSFR RFWQARAVESFLR

GTTSYADQMFLLKRGLLE HILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAK FQVFLKQINSSLVDSNMLVRCVTLSLDRFENQV

DMKV VAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQ ENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQH

YLHKDKDSTCLEN SSCISFSYWKETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTEE
Transcript ENSMUST00000103140
Sequence
GTCGGACGAGGAGACATGGCGGCAGCGCCCGCAGCGGCTGGAGCTGGGGCCAGCCGGGGGAGGCGGTTGGCAGCTACCGCGGCGGCGTGGGGCGGCTGGG

GAGGTCGACCGCGGCCGGGTAACATCCTGCTGCAGCTGCGGCAGGGCCAGCTCACCGGCCGAGGCCTGGTCCGGGCGGTGCAG - UNI2545 - TTCA

CTGAGACCTTTTTGACCGAGAGGGACAAATTGTCCAAATGGAGTGGAATTCCTCAGTTGCTCCTTAAGCTGTATGCCACCAGCCATCTGCACAGTGACTT

CGTTGAGTGCCAAAGCATTCTCAAG - UNI13213 - GAGATTTCTCCTCTTCTCTCTATGGAGGCTATGGCGTTTGTAACTGAAGACAGGAAATTTA

CTCAAGAAGCTACATACCCAAATACATATATTTTTGACTTATTTGGAGGTGTTGAT - UNI5400 - CTTCTTGTAGAAATTCTTATGAGGCCTACCA

TCTCTATCCGGGGACAGAAACTAAAAA TAAGTGACGAGATGTCGAAGGACTGCTTGAGCATCCTGTACAATACCTGTGTCTGC ACGGAAGGAGTAACG

AAGCGTTTGGCAGAAAAGAATGATTTTGTGATTTTTCTGTTCACACTGATGACAAGTAAGAAGACATTCTTACAAACAGCGACTCTCATTGAAGACATTT

TGGGTGTTAAGAAG GAAATGATCCGGCTAGATGAAGTTCCCAATCTGAGTTCCTTAGTATCCAATTTCGATCAGCAGCAGCTTGCTAACTTCTGCAGGA

TCCTGGCTGTCACCATTTCAGAGATGGACACGGGGAATGACGACAAACACACGCTTCTTGCCAAAAATGCTCAGCAGAAGAAGAGTTTGAGTTTGGGGCC

TTCTGCAGCTGAAATCAACCAAG CTGCTCTTCTCAGCATCCCTGGCTTTGTGGAACGGCTTTGCAAACTGGCAACTAGGAAAGTGTCAGAGTCAACGGG

CACAGCCAGCTTCCTTCAAGAACTGGAGGAGTGGTACACATGGCTCGACAATGCGTTGGTGCTAGATGCCCTGATGCGAGTGGCCAATGAGGAGTCTGAA

CACAATCAAG GCACTTCGGAGGAGGGTGGGCTGCCACACACCTCGGCCAGGGCGCAGCTGCCCCAGTCCATGAAGATTATGCATGAGATTATGTACAAA

CTGGAAGTGCTTTATGTCCTCTGCGTGCTGCTGATGGGGCGTCAGCGAAACCAG GTCCACAGGATGATTGCTGAGTTCAAGTTGATCCCAGGACTCAAT

AATTTGTTCGACAAACTGATTTGGAGGAAGCATTCAGCATCTGCCCTTGTCCTCCATGGCCACAACCAGAACTGTGACTGTAGCCCG GACATCACCTTG

AAGATCCAGTTTTTGAGACTTCTCCAGAGTTTCAGTGACCACCATGA GAACAAGTACTTGCTGCTCAACAACCAGGAGCTAAATGAGCTCAGTGCCATC

TCGCTGAAAGCCAACATCCCTGAGGTGGAGGCTGTCCTCAACACTGACAG GAGTCTGGTGTGTGACGGCAAGAGGGGCCTACTAACTCGGCTGCTGCAG

GTCATGAAGAAGGAGCCAGCGGAGTCTTCATTCAG GTTTTGGCAAGCCCGGGCTGTGGAAAGTTTCCTCCGAGGGACCACCTCCTATGCAGACCAGATG

TTCCTGCTGAAGCGAGGCCTTCTGGAG CACATCTTATACTGCATTGTGGACAGTGAGTGCAAGTCTAGGGATGTACTCCAGAGCTACTTTGATCTCCTG

GGAGAGCTGATGAAGTTCAACGTCGATGCATTCAAGAGATTCAATAAATATATCAACACTGATGCAAAG TTCCAGGTGTTCCTGAAACAGATCAACAGC

TCGCTAGTGGACTCCAACATGCTGGTGCGCTGTGTCACTCTGTCACTGGACCGATTTGAAAACCAGGTGGACATGAAAG TGGCCGAGGTCCTGTCCGAG

TGCCGCCTGCTTGCCTACATATCCCAGGTGCCCACGCAAATGTCCTTCCTCTTCCGCCTCATCAATATCATCCATGTGCAGACGCTAACCCAG GAGAAC

GTCAGCTGCCTCAACACCAGCCTGGTAATCCTGATGCTGGCCCGACGGAAAGAGCGGCTGCCCCTGTACCTGCGACTGCTACAGCGAATGGAGCACAGCA

AGAAATACCCCGGCTTCCTGCTCAACAACTTCCACAACCTGCTGCGCTTTTGGCAGCAGCACTACCTGCACAAGGATAAGGACAGCACCTGCCTGGAGAA

T AGCTCCTGTATCAGCTTCTCGTACTGGAAGGAGACAGTGTCCATCTTGTTGAACCCAGACCGCCAGTCGCCCTCTGCCCTCGTCAGCTACATTGAGGA

GCCCTACATGGACATAGACAGAGACTTCACTGAGGAGTGACCTTGAGCCAGGCTTCAAGAAGCTGCCAGGCAGGGGCGAGTGCAGAGAGCCAGAGTGCAC

GTGCCGCCTCGCACTCTGCCCATCCCTGTCCCTCTTGCCTCCCCAGTGCTCTGTCCACCCCGGGTGTCCAGGTGCAGGCTCAGTGGAAGGAACATCCTAG

AAGCTCTTGTCTCCTGGGTCTGAGGGCCCAGGTCATGGGGAGCCTGTTTCTTCACTGTCCCCAGGGTAAGGACAATGGCACCATGCCCACCTTTCCCTCG

CAATCCTGGAGCCCTGGCCTGCCAGAGAAGGGGAACACGGGAAACCATCTGTCTGAGCTTCTCCCATCAGTCCTGATGGAGAGGAAGATGCAGACCCCTG

TGAGCCAAACCTCCCTGGCCTCAGGACGCAGGCAGAGAGGCTCCTGAGCCCTGGGCAGGGGTGGGTATCGGAGAATGCTGCCTTCCCCGGGGTCTGCCCA

TCTCTCCCTTCCTCACCTCCCTTGTCTTCCTTTAGCTCCTCTGGTTCTTTGCTCATTGGCCACTGTGTTCATCCAGGAGGCTCCCTAGAAGTGGGGGGAG

CCTTTTCTCTCCATCCCTTGGGGCATGGAGTGCCTGTGCCTGCCTGAGCCCAGACACGGGAGCCTGGCTGAGAGCTTACCCTTGGCTCCTCCTGTGTTGC

CAGTTTATTAACAGCAAATAAACCGATTAAATG
Translation
MAAAPAAAGAGASRGRRLAATAAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQ - UNI2545 - FTETFLTERDKLSKWSGIPQLLLKLYATSHL

HSDFVECQSILK - UNI13213 - EISPLLSMEAMAFVTEDRKFTQEATYPNTYIFDLFGGVD - UNI5400 - LLVEILMRPTISIRGQKLKI I

SDEMSKDCLSILYNTCVC TEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKK EMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEM

DTGNDDKHTLLAKNAQQKKSLSLGPSAAEINQA AALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQG GT

SEEGGLPHTSARAQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQ VHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSP DITLKIQF

LRLLQSFSDHHE ENKYLLLNNQELNELSAISLKANIPEVEAVLNTDR RSLVCDGKRGLLTRLLQVMKKEPAESSFR RFWQARAVESFLRGTTSYADQ

MFLLKRGLLE HILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAK FQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVDMKV VAE

VLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQ ENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDS

TCLEN SSCISFSYWKETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTEE

For any suggestions or comments, please send an email to unitrap@crg.es