Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038332 (Sesn1)
Chromosomal location
Chr 10: 41530828 - 41628227 (+)
Description
sestrin 1 Gene [Source:MGI (curated);Acc:Sesn1-001]
RefSeq_dna
NM_001013370 
RefSeq_peptide
NP_001013388.1 
UniGene
Mm.415868 Mm.139418 
MGI
MGI:2155278 
Uniprot/SWISSPROT
P58006 
Uniprot/SPTREMBL
Q497S6 
Human Ortholog
ENSG00000080546 (SESN1)
Omim not available
UniTrap UNI31488
Vector Insertion
Chr 10: 41531107 - 41607254
Public Clones IST10992D7 (tigm) IST13011E3 (tigm) IST13074D11 (tigm) IST11407C7 (tigm)
IST12818H1 (tigm) IST10237E12 (tigm) IST11298H4 (tigm) IST10921H7 (tigm)
IST10390F7 (tigm) IST14740D3 (tigm) IST13520B4 (tigm) IST12742A5 (tigm)
IST10984G3 (tigm) IST12280H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041438
Sequence
TGAAGCGCTGCAGCGACAGATCGCGGCCGCAGCCGTCCCTTCGACATGCGCCTGGCCGCCGCGTCGAACGAGGCGTACGCAGCCTCGCTGGCTGTCTCCG

AGCTGCTGAGCTGCCACCAGTGCGGCGGGGACCGCGGCCAGGACGAG GAACTTGGAATCAGAATCCCTCGGCCACTAGGACACGGACCAAGCAGGTTCA

TCCCAGAGAAGGAG ATGCTGCAGGTGGGCAGTGAAGACGCACAGATGCATGCGTTATTTGCAGACTCCTTTGCTGCTTTGGGTCGTCTGGATAACATCA

CATTAGTGATGGTTTTCCATCCACAATATTTAGAAAGTTTCTTAAAGACTCAACACTACCTACTACAAATGGATGGGCCATTACCCCTCCATTATCGGCA

CTACATTGGAATCATG GCGGCAGCGAGGCATCAGTGTTCCTACCTGGTGAATCTGCATGTCAGTGACTTTCTTCATGTTGGTGGGGACCCCAAGTGGCT

CAATGGTTTAGAGAATGCTCCTCAAAAACTGCAGAACTTAGGAGAACTTAACAAAGTGTTAGCCCATAGGCCTTGGCTGATTACCAAAGAACATATCGAG

 GGCCTTCTGAAAGCAGAGGAGCACAGCTGGTCTCTCGCCGAGCTGGTCCATGCCGTGGTTCTGCTCACACACTACCACTCTCTTGCCTCCTTCACATTT

GGCTGTGGAATTAGTCCAGAGATTCATTGCGATGGTGGCCACACCTTCAGACCGCCTTCTGTTAGTAACTACTGCATCTGTGACATTACAAATGGCAATC

ACAGTGTGGATGAGATGCAAGTCAACTCAGCAGGAAATGCTTCG GTAAGTGATTCCTTCTTTGAGGTGGAAGCTCTCATGGAAAAGATGAGGCAGTTAC

AGGAATGCCGAGAGGAGGAGGAGGCTAGCCAGGAGGAGATGGCGTCGCGGTTTGAGATGGAAAAGAGAGAGAGCATGTTTGTCTTCTCTTCGG ACGATG

ATGAAGTTACACCAGCAAGAGATGTGTCTCGGCACTTTGAGGACACTAGTTACGGCTACAAGGATTTCTCCAGACACGGGATGCATGTCCCAACGTTTCG

TGTCCAG GACTACTGCTGGGAAGACCATGGTTACTCTCTGGTGAATCGTCTCTATCCAGATGTGGGACAGTTAATTGATGAGAAATTTCACATTGCTTA

CAATCTAACTTACAATACTATGGCCATGCACAAAGATGTTGATACCTCAATGCTCAGACGGGCTATCTGGAACTATATCCACTGCATGTTTGGAATACG 

ATACGACGACTATGACTATGGGGAAATTAACCAGCTGCTGGATCGTAGCTTTAAAGTTTACATCAAAACCGTCGTGTGCACTCCTGAAAAGGTTACCAAA

AGGATGTATGACAGCTTCTGGAGGCAGTTCAAGCACTCTGAGAAG GTCCATGTTAATCTGCTTCTTATAGAAGCTAGGATGCAAGCAGAACTCCTGTAT

GCTCTGAGAGCCATTACCCGGTATATGACCTGATGCCTCTCCTCCATTAAAGATGACCCTGGAATGAACAGCACATTTAGTGTACAAGGGGATGGAACCA

AGAGCCCCAGGACCAACAGTAGATAAAAAGCATTCAAAAATCCATGTGCCACAATTCCTTTAGTGTCTGCTATTTTACTGTGGGATCTCACTGCCTGTCT

AGCAGTGAGCACTCGGCAGCTTTGGTGTTAGAGCTGGGAAGAAAGGCTGCCGGCCACAGTGTTTGCTTTTTGACAGACAGCACGAGATGCTGTGAACTTG

TTTCAATACAGCAACTAGTAAATCTCCAGATCCCATTGCTCTGATGTGACAAGGTGACAAGACAGAGTGCGTAAAGACTGGGACGTGGCTACTAAGTTCA

CACATGCGGAATTGAGTGGCGCTCGGTGCTGCTGTGCGGGGATGAGCACATGGCTATTTGGCTGAGTGCTGCTACCACCTGAGCCCACGCCACACCTTGT

GTGCTTTTGAATTGAACTCATGCGCATTATTTTCTTGCATCTAAAAAAGCATAGAATTTTTACTCACAGCTCAGTCAAGACCGTGTTGGCGGTAACAGTT

CATTTCTTTCATTATAGTTTTTAAAATTCAGTTATTGGATGATATTGCAATGACATTCTTAAAAGATTTCCTCCAAAGAGCAATCTTAAAATGATAGTGT

GTTAATTATAAGGAAAACAGGCTATCTTTTGATGTGCGTTTCCCAATATTCTCTGAGCCTGGAGGACAGCTGTCTTGTGCGGGATTTTTGGTTCCGGTGC

CAACAATGTGGAAAATGTGGTTGCAGTCTGCTGCACAGGGAGTGCCAGGTGCATTCTGCCCCATGCCCTGCTGACCTCGGGACCCTGACTTTGAAGGTTA

TACAGCTCCTTAAAGAATAAAGCTGGAAAATATTTTAGTGAAGTTATCATATTTGTATCTTGATTTACAAAAATGCTAACTTTGAGATACAAACAGGTTT

GGAAAAAAATGTATTAAGTACTTTGTATTCTGGAACCGTAAATTGATTTTGAAGTCTGTCAGTATTACTGGTATTTTTCAATAAAGAGTAATTTCC
Translation
MRLAAASNEAYAASLAVSELLSCHQCGGDRGQDE ELGIRIPRPLGHGPSRFIPEKE MLQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESF

LKTQHYLLQMDGPLPLHYRHYIGIM AAARHQCSYLVNLHVSDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIE GLLKAEEHSWSL

AELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMQVNSAGNAS VSDSFFEVEALMEKMRQLQECREEEEASQE

EMASRFEMEKRESMFVFSSD DDDEVTPARDVSRHFEDTSYGYKDFSRHGMHVPTFRVQ DYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAM

HKDVDTSMLRRAIWNYIHCMFGIR RYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEK VHVNLLLIEARMQAELLYALRAITR

YMT
Transcript ENSMUST00000099931
Sequence
ATGGCTGAAGGAGAGAATGAAGCGAGATGGGAGGGACTGTGCAGCAGAGACACGACTACTAGAGAGACAGCACTGGAAAACATTAGGCAGATCGTTTTGA

GAAAAACCGAATACCTTCGTTCAGCGAAAGAGACACTTTCCCGACCTTCAGACGGACTTTCAAACGCGGTTTCTTTGGATGGGATGAATAAACTTCTTGC

TCATCTGCTTATGCTCTCTAAGAGATGTCCCTTTAAAGATGTGCGAGAGAGAAGCGGGCTCATTCTGAAGAGCGTCGAG - UNI31488 - GAACTTG

GAATCAGAATCCCTCGGCCACTAGGACACGGACCAAGCAGGTTCATCCCAGAGAAGGAG ATGCTGCAGGTGGGCAGTGAAGACGCACAGATGCATGCGT

TATTTGCAGACTCCTTTGCTGCTTTGGGTCGTCTGGATAACATCACATTAGTGATGGTTTTCCATCCACAATATTTAGAAAGTTTCTTAAAGACTCAACA

CTACCTACTACAAATGGATGGGCCATTACCCCTCCATTATCGGCACTACATTGGAATCATG GCGGCAGCGAGGCATCAGTGTTCCTACCTGGTGAATCT

GCATGTCAGTGACTTTCTTCATGTTGGTGGGGACCCCAAGTGGCTCAATGGTTTAGAGAATGCTCCTCAAAAACTGCAGAACTTAGGAGAACTTAACAAA

GTGTTAGCCCATAGGCCTTGGCTGATTACCAAAGAACATATCGAG GGCCTTCTGAAAGCAGAGGAGCACAGCTGGTCTCTCGCCGAGCTGGTCCATGCC

GTGGTTCTGCTCACACACTACCACTCTCTTGCCTCCTTCACATTTGGCTGTGGAATTAGTCCAGAGATTCATTGCGATGGTGGCCACACCTTCAGACCGC

CTTCTGTTAGTAACTACTGCATCTGTGACATTACAAATGGCAATCACAGTGTGGATGAGATGCAAGTCAACTCAGCAGGAAATGCTTCG GTAAGTGATT

CCTTCTTTGAGGTGGAAGCTCTCATGGAAAAGATGAGGCAGTTACAGGAATGCCGAGAGGAGGAGGAGGCTAGCCAGGAGGAGATGGCGTCGCGGTTTGA

GATGGAAAAGAGAGAGAGCATGTTTGTCTTCTCTTCGG ACGATGATGAAGTTACACCAGCAAGAGATGTGTCTCGGCACTTTGAGGACACTAGTTACGG

CTACAAGGATTTCTCCAGACACGGGATGCATGTCCCAACGTTTCGTGTCCAG GACTACTGCTGGGAAGACCATGGTTACTCTCTGGTGAATCGTCTCTA

TCCAGATGTGGGACAGTTAATTGATGAGAAATTTCACATTGCTTACAATCTAACTTACAATACTATGGCCATGCACAAAGATGTTGATACCTCAATGCTC

AGACGGGCTATCTGGAACTATATCCACTGCATGTTTGGAATACG ATACGACGACTATGACTATGGGGAAATTAACCAGCTGCTGGATCGTAGCTTTAAA

GTTTACATCAAAACCGTCGTGTGCACTCCTGAAAAGGTTACCAAAAGGATGTATGACAGCTTCTGGAGGCAGTTCAAGCACTCTGAGAAG GTCCATGTT

AATCTGCTTCTTATAGAAGCTAGGATGCAAGCAGAACTCCTGTATGCTCTGAGAGCCATTACCCGGTATATGACCTGATGCCTCTCCTCCATTAAAGATG

ACCCTGGAATGAACAGCACATTTAGTGTACAAGGGGATGGAACCAAGAGCCCCAGGACCAACAGTAGATAAAAAGCATTCAAAAATCCATGTGCCACAAT

TCCTTTAGTGTCTGCTATTTTACTGTGGGATCTCACTGCCTGTCTAGCAGTGAGCACTCGGCAGCTTTGGTGTTAGAGCTGGGAAGAAAGGCTGCCGGCC

ACAGTGTTTGCTTTTTGACAGACAGCACGAGATGCTGTGAACTTGTTTCAATACAGCAACTAGTAAATCTCCAGATCCCATTGCTCTGATGTGACAAGGT

GACAAGACAGAGTGCGTAAAGACTGGGACGTGGCTACTAAGTTCACACATGCGGAATTGAGTGGCGCTCGGTGCTGCTGTGCGGGGATGAGCACATGGCT

ATTTGGCTGAGTGCTGCTACCACCTGAGCCCACGCCACACCTTGTGTGCTTTTGAATTGAACTCATGCGCATTATTTTCTTGCATCTAAAAAAGCATAGA

ATTTTTACTCACAGCTCAGTCAAGACCGTGTTGGCGGTAACAGTTCATTTCTTTCATTATAGTTTTTAAAATTCAGTTATTGGATGATATTGCAATGACA

TTCTTAAAAGATTTCCTCCAAAGAGCAATCTTAAAATGATAGTGTGTTAATTATAAGGAAAACAGGCTATCTTTTGATGTGCGTTTCCCAATATTCTCTG

AGCCTGGAGGACAGCTGTCTTGTGCGGGATTTTTGGTTCCGGTGCCAACAATGTGGAAAATGTGGTTGCAGTCTGCTGCACAGGGAGTGCCAGGTGCATT

CTGCCCCATGCCCTGCTGACCTCGGGACCCTGACTTTGAAGGTTATACAGCTCCTTAAAGAATAAAGCTGGAAAATATTTTAGTGAAGTTATCATATTTG

TATCTTGATTTACAAAAATGCTAACTTTGAGATACAAACAGGTTTGGAAAAAAATGTATTAAGTACTTTGTATTCTGGAACCGTAAATTGATTTTGAAGT

CTGTCAGTATTACTGGTATTTTTCAATAAAGAGTAATTTCC
Translation
MAEGENEARWEGLCSRDTTTRETALENIRQIVLRKTEYLRSAKETLSRPSDGLSNAVSLDGMNKLLAHLLMLSKRCPFKDVRERSGLILKSVE - UNI3

1488 - ELGIRIPRPLGHGPSRFIPEKE MLQVGSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIM AA

ARHQCSYLVNLHVSDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIE GLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPE

IHCDGGHTFRPPSVSNYCICDITNGNHSVDEMQVNSAGNAS VSDSFFEVEALMEKMRQLQECREEEEASQEEMASRFEMEKRESMFVFSSD DDDEVTP

ARDVSRHFEDTSYGYKDFSRHGMHVPTFRVQ DYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIR RYD

DYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEK VHVNLLLIEARMQAELLYALRAITRYMT

For any suggestions or comments, please send an email to unitrap@crg.es