Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000038354 (Ankrd35)
Chromosomal location
Chr 3: 96474054 - 96494957 (+)
Description
ankyrin repeat domain 35 Gene [Source:MGI (curated);Acc:Ankrd35-001]
RefSeq_dna
NM_001081139 
RefSeq_peptide
NP_001074608.1 
UniGene
Mm.39732 
MGI
MGI:2442590 
Uniprot/SPTREMBL
A6H648 Q8BYG3 
Human Ortholog
ENSG00000198483 (ANKRD35)
Omim not available
UniTrap UNI22153
Vector Insertion
Chr 3: 96474373 - 96482055
Public Clones (sanger) CMHD-GT_518F12-5S (cmhd) IST14966F2 (tigm) IST10980E4 (tigm)
IST13819G4 (tigm) IST14556E2 (tigm) IST10880E6 (tigm) IST14987F5 (tigm)
IST10731A6 (tigm) IST14949F11 (tigm) IST11168D2 (tigm) IST14408H8 (tigm)
IST11055D3 (tigm) IST13033C9 (tigm) IST14628A7 (tigm) IST10750B6 (tigm)
IST15057G7 (tigm) IST12968A3 (tigm) IST14798C5 (tigm) IST14548E11 (tigm)
IST10437G2 (tigm) IST12788H9 (tigm) IST15057G8 (tigm) IST10411C7 (tigm)
IST11019D10 (tigm) IST14832D7 (tigm) IST11986E4 (tigm) IST13497F10 (tigm)
IST12590A9 (tigm) IST14893E8 (tigm) IST11833H6 (tigm) IST10832E3 (tigm)
IST13989C2 (tigm) IST15016F2 (tigm) IST10260G9 (tigm) IST15078D12 (tigm)
IST11089A10 (tigm) IST14933F1 (tigm) IST12257C7 (tigm) IST13064B11 (tigm)
IST13209B2 (tigm) IST14570C1 (tigm) IST14375A1 (tigm) IST13403E11 (tigm)
IST11050G10 (tigm) IST10088B7 (tigm) IST12472A12 (tigm) IST12244D12 (tigm)
IST10366C5 (tigm) IST10587G6 (tigm) IST14354E12 (tigm) IST14220G1 (tigm)
IST14795B12 (tigm) IST13984F3 (tigm) IST10807E2 (tigm) IST10467C8 (tigm)
IST13705D9 (tigm) IST14215C11 (tigm) IST15068C12 (tigm) IST14404E4 (tigm)
IST10004H2 (tigm) IST10525A2 (tigm) IST14369G9 (tigm) IST13300B4 (tigm)
IST12428F7 (tigm) IST14511F3 (tigm) IST10383A5 (tigm) IST10326A8 (tigm)
IST13239H6 (tigm) IST10605D4 (tigm) IST12590A9BBF1 (tigm) IST13662H3 (tigm)
IST10012B9 (tigm) IST10788H12 (tigm) IST10034H11 (tigm) IST13072E8 (tigm)
Private Clones OST306483 (lexicon) OST187118 (lexicon) OST166760 (lexicon) OST166117 (lexicon)
OST128026 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17262
Vector Insertion
Chr 3: 96482187 - 96483102
Public Clones IST10618E4 (tigm) IST11559D7 (tigm) IST14418C2 (tigm) IST14227F2 (tigm)
Private Clones OST446485 (lexicon) OST256024 (lexicon) OST118607 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17233
Vector Insertion
Chr 3: 96483192 - 96483552
Public Clones IST14177B4 (tigm) IST13109B6 (tigm) IST14504E3 (tigm) IST10432E5 (tigm)
Private Clones OST447124 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20190
Vector Insertion
Chr 3: 96483618 - 96484393
Public Clones IST14908E7 (tigm) IST15040G4 (tigm)
Private Clones OST369900 (lexicon) OST199929 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23525
Vector Insertion
Chr 3: 96484452 - 96484549
Public Clones not available
Private Clones OST254699 (lexicon) OST213870 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32084
Vector Insertion
Chr 3: 96484621 - 96484884
Public Clones IST10714B10 (tigm) IST10822C8 (tigm) IST14589H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31796
Vector Insertion
Chr 3: 96484992 - 96485949
Public Clones IST10052B8 (tigm) IST14538D3 (tigm) IST12656F6 (tigm) IST13043B5 (tigm)
IST10052D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34237
Vector Insertion
Chr 3: 96486135 - 96486916
Public Clones IST10115B9 (tigm) IST11209H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31125
Vector Insertion
Chr 3: 96486955 - 96487105
Public Clones IST12409F10 (tigm) IST12963H5 (tigm) IST10934F1 (tigm) IST13074C6 (tigm)
IST10283F6 (tigm) IST10236H1 (tigm) IST10386H10 (tigm) IST10934G1 (tigm)
IST12024A10 (tigm) IST12860H11 (tigm) IST13606G7 (tigm) IST12455B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12962
Vector Insertion
Chr 3: 96489098 - 96493068
Public Clones CMHD-GT_429C12-3 (cmhd) CMHD-GT_355G10-3 (cmhd) IST14688E5 (tigm) IST12032E8 (tigm)
IST14190A11 (tigm) IST13741E10 (tigm) IST14939H7 (tigm) IST12110A5 (tigm)
IST13543B9 (tigm) IST14939H6 (tigm) IST14758B10 (tigm)
Private Clones OST437814 (lexicon) OST405383 (lexicon) OST324368 (lexicon) OST324143 (lexicon)
OST322794 (lexicon) OST236420 (lexicon) OST136399 (lexicon) OST126286 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23164
Vector Insertion
Chr 3: 96493434 - 96494114
Public Clones not available
Private Clones OST274288 (lexicon) OST195744 (lexicon) OST87706 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048427
Sequence
GAAGGGCGGAACTTGAGAGCCAGCCAGGGTGGCCGCAAAAGACTGCGGGCTTTTTGCCTCTGCAGGGACGGGGTTAGGCAGGGCCAGAGGCGGGGTTTTA

AGCCCAGCCTTCAGTTGAACGTCTACGATTGAGCGGGGTGGGATCTGGGGCGGGGCTTGGGGCGGGACCCAGTCTGCTTTTTGACAGCTGTCTTTCGGCA

CAGCCGTAGCCGAGTTGGGTTAGGAACTTGTGGCCCGGCTCTCTGCGCGTCCCCGTCCCCCCGTGGCCCTAGCCCCGGCCATGAAGCGCATCTTCTCCTG

CTCCAGTTCACAAGTGGCG - UNI22153 - GTGGAGAAATGGAACCGACGTGATCAGAAGCTGCTGGAGGCGGTGCAGCGGGGGGACGTGGGACGCG

TGGCTGCCTTGGCCTCTAGGAAGTCAGCCCGACCCACCAAACTAGACTCAAATGGCCAGTCCCC - UNI17262 - GTTCCATCTGGCAGCCTCCAAA

GGCCTGACAGAGTGTCTGACAATACTGCTTGCAAATGGGGCTGATATCAACAGCAAGAACGAGGACG - UNI17233 - GAAGCACTGCCCTTCATTT

GGCCACCATCTCCTGTCAGCCACAGTGTGTGAAGGTCTTGCTTCAG - UNI20190 - CACGGTGCTAATGAAGATGCTGTGGATGCAGAAAATCGCA

GTCCATTACACTGGGCAG - UNI23525 - CCTCCTCTGGCTGCGCCTCAAGTGTCCTCCTGCTGTGTGACCACGAAGCCTTCCTGGACGTGCTGGAT

AAT - UNI32084 - GATGGACGCACACCCCTGATGATTGCATCGCTGGGTGGTCATGCAGCTATCTGCTCACAGCTGTTGCAGAGAGGTGCCCGAGT

TAATGTCACAGACAAGGATGACAA - UNI31796 - ATCAGCTTTGATCCTGGCCTGTGAGAAAGGCAGCGCTGAGGTGGCCGAGCTGCTCCTGAGCC

ATGGAGCGGACGCTGGAGCGGTGGACAGTTTGGGACACAACGCTCTTCATTATGCTTTGCGTACACAAGACAAGGAGCTGTGGAGGCTGTTACAGCAGGC

CCTGAACCGGCGGCGGAGAGGCG - UNI34237 - GTCATGGACTGGTTCAACACCCAGATCACCCATCTCAG - UNI31125 - GCCTCTTCATG

TGAGCCTCGGGTGGGATCTCCTCCTAAGAACTCACGGAAAGTGGAGCCTGAGGAAGAGCAGGAGGAGGAGGGGGAGGAGCGGTGCTCAGAAGAGTGGAGG

TGGAAGTTCGAGGAGGAGCAGAGGAAAGTTCATCAGCTGGAGCAGGAGCTCGTGCGAAAGACAGATGAGTGCAAGGCTCACGCTGCAGCCTTCTCAAGCC

TAGAGGAGCAGATTCGAGAGCAAGCGCAAGAACTAGGCCATCTCCTAGTGCAAGAACCGGGAGCTCCAGGAAATCAAGGCCCTGGTCTCCGGCCTGAGGG

AGATGGTATGGAGGAGGGTTGTCCCCTGAACCTGCTGGCTGAGCGGATCCAAGAGCTGAAGAAGCAGCAGAAGGCACTGGCTACAATAAACCCAACATTA

GTTCCCAAGAGAGCTGAAGAATTAGCCCCGGCTGAGATCCATCATGAAGTACACAGAAAGTCCCAACCAGAGCAGGGGCTGCCCCAGGGCCCAAGTTCAG

AAACCACCGGGAAAGCCACAGGACAGCAACCAAACACCAATGGGGGGCAGAACCTTGGCCTCCAGAACACTGAGCAGGTGTGTGCTGGCCAGAAGGAGAG

GACCCCAGCTCCAGGGACTGAAACAGCAGGCACAGTGGGAGAACCAGTGGGCATAGCCATGAATCAGCTCCTCCTACAGCTAAGGGAAGAGCTGGCTGCA

GTGTGGCGAGAAAAGGATGCTGCCAGAGGGGCTTTGTCAAGACCAGTTCTGGAGGGAGCCCTGGGGACTCCCAGAGCTGAGGCTGCAGCAGCTGCCTGGG

AAAAGATGGAAGCCAGGCTTGAGAGGGTGCTGGTAAGGTTAGATGGAGCAAAGATGGGACTGCATGTGAAACCTGAGGTCCCTGTCCAGGGGTCCAGAGA

CGGAGCCCCGAAGGCAGTCCCGGGATGCTCTAAAGAGCAGGAAGAAAAGAAGGCTCTTGGAACCAGAGGAGAGCCCTTAGGGGCCCCTGGAAAAGAACAG

GCCTTAGGAGGAGGCCTGGCAAAGGGACAGCTGGAGAAAGAGGTGTCAGCTTTGAGACTGAGCAATAGCAACTTGCTGGAGGAATTGGGAGAGTTGGGGC

GCGAGAGACAACGCTTGCAGGGAGAGCTGCAGTCCTTGACCCAGAGGCTACACCGGGAGTTTGTGCCCAAGCCCGAGGCACAGGTCCAGCTACAGCAGTT

GCGGAGGAGCGTGGGGATGTTGACAGAGGAACTGGCCATGGAGAAGGAGGCCACAGATAAGCTGCGCAGGCTACTGGCCTCCCAGACTAGCGGCCTCCAA

GGACTGTGGAAATGCCTACCCCCAGACCTCGTGGGCAAGGGGAATACACAGAGTACAGCTGCAGAACCCCTGGAGGAGCTGCAGGCCTGCATCAGCACCC

TGGTGGATAGGCACCTTGAGGCTCAACGGGTGCTGGCTCGGTTGGAAGAGGAAAACCAGCAGCTGAGGGGATCCTTGGCTCCCTGTGGGGAACCAGAGGC

CTCCCTCAAGGTTACAGCATCCCCGCAAGTGGCCGCCCTGGAGGAAGATCTGGGAATGCTAGAGGAAGAGCTACGGGCCGTGCAGGCCACGATGAGTGGG

AAGAGCCAGGAGATTTGCAAGCTGAAACAACTGCTCTACCAAGCCACGGAAGAAGTGGCCGAGCTGAGAGCTCGGGAAGCAGCCAGCCTGCGCCAGCACG

AGAAGACGCGAGGCTCGCTGGTGGCCCAGGCACAGGCTTGGGGCCAGGAGCTCAAAGTCGTGCTGGAGAAGTACAACACAGCCTGTCGGGAAATGACTCG

ATTGCGGGACACTGTGGCGGAGGAACGTCGCCGCAGCGAGGACCTGGCGGCTAGGGCGGCGGAGCAGGAGCGCCAGGCTGGCGAGATGCGCGGGCGCTCG

GAGCAGTTCGAGAAAACTGCTGAGCTCCTGAAAGAGAAGACAAACCACCTCATCGGGGCTTGCCGGGACAAGGAAGCCAAG - UNI12962 - ATCAA

GGAGTTGCTGAAGAAGCTCGAGCAGCTTTCGGAAGAAGTTCTAGAAGTCCGGGGCGAGAATGCCCACCTCGCCCTACAGCTGCAG GACTCCCAGAAGAA

CCACGAAGAGATCATCTCCACATACAGGAGTCATCTACTGAATGCTGCTCGG - UNI23164 - GGCTACATGGAACAAGACGTCTACAACATCCTAC

TTCGAATCCTCAGCATGCAGGAGTGAGGCAGGCTCACTGTGTGCCCTCAGGGATAAAGGCATTTCTCTTTTGTGAGTTGTGGGTGGAGGCTAAAGAGGGC

TGGGGCTATGGAGAAAGGACTTGGGGGGAAGGGACACTTATAGAAGGATGGGGTGGCTTTTTTGTTTTTGTTTTTGTTTGCCTCTCTGGTGGCTGACACT

GGGGAGTCCTGTAGGGCATAGAGCATTGAAGTAAAGTTAACTGAAAATATAAAGTGTGGGTCACTAGGGGGAGTCAGGACCTTGTGAGCAGGTGGCACAA

GATTAGTGACTAACGGGATGACTGTGGATAGGACAGACAGTAAAGATGGCTGGAATATTTTCCTAAAGTCTGGGGTACAGAGATGCCAGTTAAGAATGAA

GGGTAGTGGGACAGTTGTTCCCTAGGGCGGAACTTTACGGACCTCAGGCTTTCTCACCCTTCACTCAAAATCCAACCATCTCCCAGCCTCCCTCCTACCC

CTTTGTGGGCAGCCCTCTTTCCAGTTTGGAAAGACAAGCAGACCCTTTAACACGTCAATGTGGATAGGAGGAGAGCGAGGATACAGAATTCATCTTTGAA

TTTCTTCTTTTAGGGAATAATGAGGCTCGATCAAGCTGTGGTGGGCAGGTGGGTGGACGGTGATTACCCACTAGTGGTGCTGTGGGTGGGGCTTCACAGG

ACACACGAACTCCAGACCTGAAAACCTGGACCCTGGAATCAGCACAGATGAGACCAGAATTGTGGATGTAAATTAGCTCCGTGGAAAATAAAGCAGAAAA

CAGATGGTC
Translation
MKRIFSCSSSQVA - UNI22153 - VEKWNRRDQKLLEAVQRGDVGRVAALASRKSARPTKLDSNGQSP - UNI17262 - PFHLAASKGLTECLT

ILLANGADINSKNEDG - UNI17233 - GSTALHLATISCQPQCVKVLLQ - UNI20190 - HGANEDAVDAENRSPLHWAA - UNI23525 - 

ASSGCASSVLLLCDHEAFLDVLDN - UNI32084 - DGRTPLMIASLGGHAAICSQLLQRGARVNVTDKDDK - UNI31796 - KSALILACEKGS

AEVAELLLSHGADAGAVDSLGHNALHYALRTQDKELWRLLQQALNRRRRGG - UNI34237 - GHGLVQHPDHPSQ - UNI31125 - ASSCEPRV

GSPPKNSRKVEPEEEQEEEGEERCSEEWRWKFEEEQRKVHQLEQELVRKTDECKAHAAAFSSLEEQIREQAQELGHLLVQEPGAPGNQGPGLRPEGDGME

EGCPLNLLAERIQELKKQQKALATINPTLVPKRAEELAPAEIHHEVHRKSQPEQGLPQGPSSETTGKATGQQPNTNGGQNLGLQNTEQVCAGQKERTPAP

GTETAGTVGEPVGIAMNQLLLQLREELAAVWREKDAARGALSRPVLEGALGTPRAEAAAAAWEKMEARLERVLVRLDGAKMGLHVKPEVPVQGSRDGAPK

AVPGCSKEQEEKKALGTRGEPLGAPGKEQALGGGLAKGQLEKEVSALRLSNSNLLEELGELGRERQRLQGELQSLTQRLHREFVPKPEAQVQLQQLRRSV

GMLTEELAMEKEATDKLRRLLASQTSGLQGLWKCLPPDLVGKGNTQSTAAEPLEELQACISTLVDRHLEAQRVLARLEEENQQLRGSLAPCGEPEASLKV

TASPQVAALEEDLGMLEEELRAVQATMSGKSQEICKLKQLLYQATEEVAELRAREAASLRQHEKTRGSLVAQAQAWGQELKVVLEKYNTACREMTRLRDT

VAEERRRSEDLAARAAEQERQAGEMRGRSEQFEKTAELLKEKTNHLIGACRDKEAK - UNI12962 - IKELLKKLEQLSEEVLEVRGENAHLALQLQ

 DSQKNHEEIISTYRSHLLNAAR - UNI23164 - GYMEQDVYNILLRILSMQE

For any suggestions or comments, please send an email to unitrap@crg.es